KEGG   Staphylococcus epidermidis ATCC 12228: SE1870Help
Entry
SE1870            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_27 MarR
Motif
Other DBs
NCBI-GeneID: 1055727
NCBI-ProteinID: NP_765425
UniProt: A0A0H2VHW7
Position
complement(1906113..1906841)
Genome map
AA seq 242 aa AA seqDB search
MQQQKIKRFLAHFVLDHVTIEYLKYGHQLTIEQLKLLIFILHFTENHKEDLSLNMIIFYK
NYQKNQLLKSITHLYEFNWISKKRHPYDQRRLVITLTQNQCSKITQLIEELEHFLEVKST
LINEINHSTLLSYYLKCHSQFRVIEQSCTSQHLTLEELYLLGLLIISDNKTTFKSIKVHA
LKGIIAMGPIIKTLQSKGYLIKSRSRDDERYIVLTLRKEKVNVIQSEIEECYNKLEQGIQ
HV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacagaagattaaacgattcttagcccattttgtattagatcacgtcacaata
gaatatttgaaatatggccaccagttgacaattgaacagcttaaattattaatatttata
ttacatttcactgaaaatcataaagaagatttaagtttaaatatgatcatcttttacaaa
aattatcaaaaaaaccaattgttaaaaagtattacacatctatatgaatttaattggatt
tcaaaaaaacgacatccatacgaccaacgtagactagttattacattaactcaaaatcaa
tgtagtaaaataactcaattaattgaagaattagaacacttcttagaggttaaatctaca
ttaataaacgaaattaatcattcaactttattatcgtattatttaaagtgccatagccaa
tttagagtaattgaacaatcttgcacctctcaacatttaacattagaagaattatacctt
cttgggttacttatcattagtgataacaagactacatttaaaagcataaaagtacatgct
ttaaagggaatcattgcaatgggacctattattaagaccttacagtcaaaaggttatctc
attaaaagtcggagtagagatgatgaacgctatattgtattaacacttagaaaagaaaaa
gttaatgtgattcagtcagaaatcgaggaatgttacaataaattagaacagggaatacag
catgtgtaa

DBGET integrated database retrieval system