KEGG   Staphylococcus epidermidis ATCC 12228: SE1941Help
Entry
SE1941            CDS       T00110                                 

Definition
two component response regulator
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1973446..1974120
Genome map
AA seq 224 aa AA seqDB search
MINCLIVDDDKKLLQYVSSHLERESIQTHTFTSGEASLDFLENKNVDIAIVDIMMSGMDG
FELCQTLKDDYHIPVIMLTARDALSDKERAFLSGTDDYVTKPFEVKELLFRIKAVLRRYQ
INADNELQLGNLILNQSYMEITVGSKTMNLPNKEFQLLFLLASNPKHIFTRDDIIGKIWG
FDYEGDDRTVDVHIKRLRQRLSKLKSSVSIQTVRGQGYRVDQNV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattaattgcttaatcgtagacgatgataaaaagttattgcaatatgtttcaagtcat
ttagaaagagaaagtattcaaacacatactttcacaagtggagaagcatcactagatttt
cttgaaaataaaaatgttgatattgcgatagtagatattatgatgagtggaatggatggt
tttgagctttgtcagactttgaaagatgattatcatattcctgtcataatgttgacagct
agagatgcattaagtgataaagaacgtgcatttctaagtgggactgacgattatgtcact
aaaccttttgaggttaaagaattattatttagaattaaagctgtcttaagacgatatcaa
attaatgctgataacgagttacaacttggcaacttaatattaaatcagtcttatatggaa
attactgtgggttcaaaaacgatgaatcttccaaacaaagaatttcagttgttattttta
ttagcctctaatcctaaacatattttcactcgagatgatattattggaaaaatttggggc
ttcgattatgaaggagatgatcgtactgttgatgttcatattaaaagattacgtcaacgt
ttatctaaattgaaatcatcagtatcaattcaaactgtaagaggtcaaggatatagggtg
gaccaaaatgtttaa

DBGET integrated database retrieval system