KEGG   Staphylococcus epidermidis ATCC 12228: SE1944Help
Entry
SE1944            CDS       T00110                                 

Definition
hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1977410..1978567
Genome map
AA seq 385 aa AA seqDB search
MFYAMKSFTFFMHNIYAMGGTVKSVTQLANTLAEKGHPVTIISVFRGADSPYFELHSAIK
VKVLVDYRLKLKNTRAITANRIKKYTPFLNTKVISQFEPGKSQFSSYVEKKMIKAIRHTK
TDVLVGTRASFNILISKYAKAEIVTIAMEHMNFDAHPDQYQKEIIAAYRNINKITTLTAA
DQQKYQSQLKTPVYVIPNMVTEKRIAAPKKNRIISAGRLEYEKGYDLLLESIRLIQEDLR
QLNYDVHIYGSGSKKTSLVDFINQYHLNDLIKIYEPTQELNNKLAQSKIVVVPSRNEGFG
MIILEAMVQDNIVISFEGNVGPDSIINNGDNGYLVNYENVSELAKRIDLTTQHYNELDHI
IENSKDTLKQFSPDHIYQLFMSMFK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgttttacgcaatgaagtcgttcacattttttatgcataatatttatgcaatgggcgga
acggtaaagtcggtgacacaacttgcaaatacactggcagaaaaaggacatcctgtaaca
attatttcagtttttagaggcgcagactctccatattttgaattacattcagcaataaaa
gttaaagtcttagtggactatcgcttaaagcttaaaaatactagagctattacggcaaat
cgtatcaaaaagtataccccctttttaaatacaaaagtgatttctcaatttgagccaggt
aaaagtcagttttcgagttatgtagagaaaaaaatgattaaagcaatcaggcatactaaa
actgatgtactcgttggaacaagagctagctttaatattctcatttctaaatatgctaaa
gctgaaatagtgaccatcgcaatggaacatatgaattttgatgctcaccctgatcagtat
caaaaggaaattattgctgcgtaccgtaatatcaataagattacaacgttaactgccgca
gaccagcaaaaatatcaatcacaacttaaaactcctgtatacgttatacctaatatggtt
accgaaaaaagaattgctgctccaaagaaaaatcgtattattagcgccggacgtttagaa
tatgaaaaagggtatgatttattattagagagtattcgtttaatacaagaagacttgcgt
caattgaattatgacgttcacatctatggttctggtagtaagaaaacatcacttgttgac
tttattaatcaatatcatttaaatgatttgattaaaatatatgagccaacgcaagaatta
aataataaacttgcacaaagtaaaatcgttgttgtaccttcacgcaatgaaggtttcgga
atgattattttagaggcaatggtgcaagataatatagtaataagttttgaaggcaatgta
gggccagattcaatcattaacaacggagataatggttatttagtaaactatgaaaatgtg
tctgaacttgcaaaacgtatcgatttaacaacacaacattataatgagttagatcacatc
attgaaaatagtaaagatacgttgaaacaatttagtccagatcatatatatcaattattt
atgtctatgtttaaataa

DBGET integrated database retrieval system