KEGG   Staphylococcus epidermidis ATCC 12228: SE1961Help
Entry
SE1961            CDS       T00110                                 

Definition
transcription regulatory protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1995317..1997422
Genome map
AA seq 701 aa AA seqDB search
MTCFLNIYKEYHSPPERNINRIILMFSLTNDLKITINGETKDLGNHIAIINQSDIYFINS
ASNLVLLSIPVIYFYSKDNKFFKCYFDRHLLQSSSFVKTIILQAIQHLIKGENQDEQSIS
KIIQTLLKEAVIRYKKKYIPQIAVNHSVFTEGLTFIHSKVSQSLSLREVAQHCNISESYC
SNLFARYLNMNFKDYFTSLKVIDSIKRLLSSEDSINAISEQSGFSSHTNFTNQFKNYLGC
SPKQYRTIISKLDPLPSISFSDTDFSQYIELINQFEFSDHWATETTERDINEFYPQDQTK
NSKAFIRFQNFNELFQFVFNEYYNIDLTSLPQAVIFINDITDISTREVNFNLLNRCFEKL
FEKNIGLAMRLTSTNEFESIKEIILLFLNSHQDYKMNKKMVKFMLVFETENMSVNDIHLC
HLKIKNKNKAIRYSITVEGLLHQNSSIDRTYDMMKRLNFDYYFIDIENLETKNSLITKRK
SYLHSSTHFENYKQFILDSGIPSTKFVYNNLSLKCFKYTNNGTYPLQLSDLVCHLVALMR
YGGGVSYQLIEDESPFIALFNRYGSPLPLMHLYKLIEPFLNEPLEIANNFLMSRKDGNYH
FLLFNKINDRYLSDSQQRYVFKNTLSTNSLIIIKTLNHEHGAIQNLLPQTKQQFYIERSI
LDELDKSNQPKTELAIQHDHHLPFHVTLKHDEVKYICFKPS
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgacatgttttttaaatatatataaagaatatcattctccccctgaacgcaatattaat
agaattattctaatgttttcacttacaaatgacttaaaaatcactattaatggtgaaaca
aaagatttaggtaatcatatagctatcattaatcaatctgacatctattttattaatagt
gcttcaaatctcgtattactctctattccagttatttatttttatagtaaagataataaa
ttttttaaatgttattttgacagacatttattacaatcaagcagttttgttaaaacaatt
attttacaagctattcaacatttaataaaaggagaaaatcaagatgagcaatccatctct
aaaataatacaaacgctactaaaagaagcagtcattcgatataagaaaaaatatattcct
caaattgcagttaatcattcagtgtttactgaaggattaacatttattcattcaaaagta
tcacagtcactctcactacgagaagtagctcaacattgtaatatatctgaatcttattgt
tctaacctatttgcaagatatcttaatatgaattttaaagattattttacaagcttaaaa
gtgattgactctataaaaaggctactttcatctgaggactcaattaacgctatttcagaa
caatctggatttagtagtcataccaattttacaaatcaatttaaaaattatttaggttgt
agcccaaaacaataccgaacgattatctctaagttagaccccttaccttcgataagtttt
agtgatactgacttttcacaatatattgaattaattaatcaatttgagtttagtgatcat
tgggctactgaaacgactgaaagagatatcaatgaattttatcctcaagatcagactaaa
aactctaaagcgtttatacgttttcaaaatttcaacgaattatttcaatttgtttttaat
gaatattacaacattgatcttacctccctgccacaagctgtaatttttatcaatgatatc
actgatatttcgacgcgagaggtgaactttaatttattaaatcgatgctttgaaaaatta
ttcgaaaaaaatataggtttagccatgagattaacatctacaaatgaatttgaatctatc
aaagaaataattttattatttcttaatagccaccaagattataaaatgaacaaaaaaatg
gttaaatttatgttagtctttgaaactgagaatatgtcagtgaacgatatacatttatgc
catttaaaaattaaaaataaaaataaggctatccgttatagtataactgttgaaggatta
ctacaccaaaattcttctattgatcgaacttatgatatgatgaagcgattaaatttcgat
tactattttatagacattgaaaatctagaaaccaaaaactcattaattaccaaacgtaaa
tcgtacttacattcgtccacacactttgaaaattataaacaatttatattagattccggt
ataccttcaactaaatttgtttacaataatttatctttaaagtgttttaaatatacaaac
aatggtacttatccacttcaattatctgaccttgtttgtcatttagtcgcattaatgcgt
tacgggggtggtgtaagttatcaactgatagaagatgagagtccttttattgccttattt
aatcgttatggtagtcccctacctctcatgcacctctataaattaatcgaaccattttta
aatgaacctttagagatagctaacaattttttaatgagtcgcaaagatggtaactatcac
tttttattatttaataaaataaatgatcgttatctatctgacagtcaacagcgctacgtt
tttaaaaatacattatcaaccaactcattaattattattaaaacgttaaatcatgagcat
ggcgcaattcaaaaccttctaccacaaactaaacaacaattttatattgaacgtagtatt
cttgatgaacttgataaatcaaatcaaccaaaaacagaattagctatacaacatgaccat
catcttccttttcatgtcaccttaaaacacgatgaagtcaaatatatttgttttaaacct
tcttaa

DBGET integrated database retrieval system