KEGG   Staphylococcus epidermidis ATCC 12228: SE1969Help
Entry
SE1969            CDS       T00110                                 

Definition
response regulators of two-component regulatory
Orthology
K07696  
two-component system, NarL family, response regulator NreC
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Two-component system
Module
NreB-NreC (dissimilatory nitrate/nitrite reduction) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sep02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2003980..2004636)
Genome map
AA seq 218 aa AA seqDB search
MKIVIADDHAVVRTGFSMILNYQEDMEVVATAADGVEAYQKVLEHRPDVLILDLSMPPGE
SGLIATSKISESFPETKILILTMFDDEEYLFHMLKSGAKGYILKNSPDEQLILAVRTVYQ
GETYVDMKLTTSLVNEFVNQSQTDEVSSSSDPFKILSKRELEILPLIAKGYGNKDIAEKL
FVSVKTVEAHKTHIMTKLNLKSKPELVEYALKKKLLEF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagttatagcggatgaccatgcagttgttaggacaggattttcaatgatatta
aattatcaagaagatatggaagttgttgcaactgcagctgacggggttgaagcttatcaa
aaagtgttagaacatcgaccagatgttttaattttagatttgagcatgccaccaggagag
tctggcttaatcgcaaccagtaaaatttctgaaagttttcctgaaactaaaattttaata
cttacgatgtttgatgacgaagaatatttatttcatatgttaaaaagtggtgctaaagga
tacattttaaagaattcacctgatgagcaattaatattggccgtacgtacagtatatcaa
ggtgaaacttatgttgatatgaaattgacgacgtctttagtcaatgagtttgtcaatcaa
tctcaaacggatgaagtgtcatcctcttcagatccatttaaaattttatcgaaacgagag
ttagaaatattacctcttatagctaaaggctatggcaataaagatattgcagaaaagttg
tttgtatcagtgaaaacggtagaggcacataaaacgcatattatgacgaaactaaattta
aagagtaaacctgaattagttgaatatgccttaaagaaaaaattattagaattttaa

DBGET integrated database retrieval system