KEGG   Staphylococcus epidermidis ATCC 12228: SE1978Help
Entry
SE1978            CDS       T00110                                 

Definition
(RefSeq) nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00910  Nitrogen metabolism
sep01120  Microbial metabolism in diverse environments
Module
sep_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SE1978
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     SE1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Pyr_redox_3 NIR_SIR_ferr NAD_binding_7 NAD_binding_9 DAO HI0933_like GIDA NAD_binding_8 AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 1057858
NCBI-ProteinID: NP_765533
UniProt: A0A0H2VHY0
Position
complement(2014067..2016472)
Genome map
AA seq 801 aa AA seqDB search
MAKQKLVMIGNGMAGLRTIEEILERSQSQFDITIIGKEPYPNYNRIMLSNILQKKMTVED
TIMNPYDWYQENNIELINNDPVEKVDKENKIVTTSKGIEVEYDICIFATGSKAFVLPIPG
SNLPSVIGWRTIDDTNKMIEIAQTKKRAVVIGGGLLGLECARGLLDQGMEVTVLHLADWL
MEMQLDRKAGEMLKADLEKQGMKIELQANSKEIIGDKDVEAIKLADGRVIETDLVVMAVG
IRPYTEVAKDSGLDVNRGIVVNDYMQTSDSHIYAVGECAEHDGKVYGLVAPLYEQGKVLA
DYLTGKETKGYKGSTAFTSLKVSGCDLYSAGQIVEDEDVHGVEIFNSVDNIYKKVYLSQG
QVVGAVLYGDTDDGSRFYNMMKKHETLEDYTLVSLLHKGDEDAGTSIADMSDDETICGCN
GVDKGTIVNAITTKGLTSVDEVTKATKAGNSCGKCKGQIGELLQYTLGDDFIAAKPTGIC
PCTDLTRDQIVTQIRAKNLKSSKEVRHVLDFKDKDGCPKCRPAINYYLNMVYPFEHRDEK
DSRFANERYHANIQNDGTFSVIPQMRGGVTDADQLIRLGEVAKKYNVPLVKVTGSQRVGL
YGLKKEELPQVWKDLGMRSASAYGKKTRSVKSCVGKEFCRFGTQYTTRLGIRLEKTFEYI
DTPHKFKMGVSGCPRSCVESGVKDFGVISVENGYQIFIGGNGGTDVTVGKLLTTVETEDE
VIQLCGALMQYYRETGVYAERTAPWLERMGFENVKNVLLNQEKQKELYLRIMEAKKAVEN
EPWETIVENKEAQKIFEVEKV
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaaaaacttgtaatgattggtaatggtatggcaggtttaagaacgatagaa
gagattttagaacgttcacaatcacaatttgatattactattattgggaaagaaccttat
ccgaactataacagaattatgttatccaatattttgcagaagaaaatgaccgtcgaagat
acaattatgaatccttatgattggtatcaagagaataatattgaacttataaataatgat
ccagtggaaaaagttgataaagaaaacaaaatagttactacttctaaaggtattgaagta
gagtatgacatttgtattttcgctactggatcaaaagcttttgtattacctataccaggt
tcaaatcttcctagtgtcattggatggcgaacaattgatgatacaaataaaatgattgaa
attgcccaaacgaaaaaacgcgcagttgtcattggtggaggtcttctaggcttagagtgt
gccagaggacttctagatcaaggaatggaagtgacagttcttcatttagctgattggctc
atggaaatgcaattggatcgtaaagccggagaaatgcttaaagcggatttagaaaagcaa
ggtatgaagattgaacttcaagcaaattctaaagaaatcattggtgataaagatgttgaa
gctattaaattagctgacggtcgggtgattgaaacagatttagtagttatggctgttggt
atcagaccttatactgaagttgctaaagatagtggattagatgtcaatagaggtattgtt
gtaaatgattatatgcaaacatctgattctcatatttatgcagtcggtgaatgtgccgaa
catgatgggaaagtttatggattggtggcgccactttatgaacaaggcaaagtgctagca
gattatttaactggtaaagaaacaaaaggttataaaggatctactgctttcacttcactt
aaagtatctggttgtgatttatatagtgcagggcaaattgttgaagatgaagatgtccat
ggtgtggaaatttttaatagtgtcgacaatatctacaaaaaagtgtatttaagtcagggt
caagtcgttggtgctgtcttgtatggtgatactgatgatggatcacgattttataatatg
atgaaaaaacatgaaacgcttgaagattatacacttgtttctttattgcataaaggtgat
gaagatgcggggacatctattgctgatatgtctgatgatgaaacgatttgtggatgtaat
ggtgttgataaaggaacaatcgtcaatgctattacaactaaaggtttaacgtctgtagat
gaagtgactaaagcaacaaaagcaggtaattcatgtggtaagtgtaaaggtcaaatcggt
gagttattacaatatacattaggtgacgactttattgctgcaaaaccaacaggtatttgt
ccatgtactgatttaacaagagaccaaattgtaactcaaatcagggctaaaaatctcaaa
tcatcaaaagaagtacgacacgttcttgatttcaaagataaagatggttgtcctaaatgt
cgacctgcaattaattattatttaaatatggtttatccttttgaacatcgagacgaaaaa
gattctcgcttcgctaatgaaagatatcatgcaaatatacaaaatgatggtactttctca
gtgattcctcaaatgcgcggtggtgttacagatgctgaccaactcattcgattaggagaa
gttgctaaaaagtataacgtaccacttgttaaagtaacaggttcgcaacgtgtaggttta
tatggattgaagaaagaagaattaccacaagtttggaaagatttaggaatgcgttctgct
tctgcttatggtaaaaagacgcgttctgttaaaagttgcgttggtaaagagttttgtcgt
tttggtacacaatacacaactcgactaggaataagacttgaaaaaacatttgaatatatt
gatacacctcataaatttaaaatgggagtatcaggttgtccgagaagttgtgtagagtct
ggtgttaaagattttggcgtcatatctgttgaaaatggctaccaaatatttatcggaggt
aatggtggtactgatgttactgtaggtaaattgttaacgacagttgaaaccgaagatgaa
gtgattcaattatgtggtgccctcatgcagtattacagagaaacaggtgtttacgctgaa
agaacagcaccatggttagaacgtatgggctttgaaaatgtcaagaatgtcttattaaat
caagaaaagcaaaaagaactgtatttaagaattatggaagccaaaaaagctgttgagaat
gaaccatgggaaactattgttgaaaataaagaagcacaaaaaatctttgaagttgagaag
gtgtaa

DBGET integrated database retrieval system