KEGG   Staphylococcus epidermidis ATCC 12228: SE1981Help
Entry
SE1981            CDS       T00110                                 

Definition
(RefSeq) nickel ABC transporter nickel-binding protein
  KO
K02035  
peptide/nickel transport system substrate-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
Peptides/nickel transport system
Brite
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    SE1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2017879..2019354
Genome map
AA seq 491 aa AA seqDB search
MKKLITLIVMISFVLASCGGTSSTDKDTLNVEIPLKTKSIAPYETDIPVKTGALESLFKM
SKNGKVKPLLVKNYHQVSDNQLELTLKDNIKFQNGHHLTGEAVKRSLEEGMKKSDLLKGS
LPIKSINAHGQKVTINTKEPYPELMSELASPFAAIYDTKAKNKVTDQPVGTGPYKIDQYK
RSQKIVLKQFKDYWQGTPKLKRINVTYHEDGNTRVDHLLSGKSDLTTDVPIERVDDVKKS
NKANIQSTSGFRTHLMLYNHDSKKVNKKVREALDMIINRKDIAKNISKNYAEPASGPFNH
RLKSLEKEEIQSQDIKRAKELLAQEGYSKSHPLKLNMVTYDGRPELPKIGQVIQSEAKKA
NVDIQLRNVDDIEGYLKNKQGWDVSMYSYLSVPRGDTGYFFNTAYLPDGALNKGNYSNTK
VTQLIKELNTTFGDKQRGQVTNEILNESKKDIPNSYITYNSQIDGVNNKVRHFNVTPESI
YLIDYKLSKKE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgattactcttattgtcatgatatcttttgttttagcgagctgtgggggc
acctcaagtacagacaaagacaccctcaatgttgaaatacctttgaaaactaaatcaatt
gcaccttacgaaactgatatcccagttaaaacaggtgccttggaatcgctttttaaaatg
tcgaagaatggtaaagtaaaacctttattagtcaaaaattatcatcaagtatctgacaat
caactagaactcactttaaaagataatattaaatttcaaaacggtcatcatttaacaggc
gaagctgtaaaacgcagtctcgaagaaggaatgaaaaaaagtgatttgttaaaaggatca
cttcctatcaaatcaatcaatgctcatggacaaaaagtcacaatcaatactaaagaacct
tatccagaattaatgtctgaactcgcaagcccatttgctgctatttacgacacaaaagct
aaaaacaaagtaactgatcaacctgttggtacgggtccttataaaattgatcagtataaa
cgttctcaaaaaatcgtactaaaacaattcaaagactactggcaaggtacgccaaaatta
aaaagaattaatgtcacttatcatgaagatggtaatactcgtgttgatcacttattatca
ggcaaatcagatttgactactgatgttccaattgaacgcgttgatgatgtaaaaaaatct
aacaaagcaaacattcaaagtacatcaggctttagaacgcatttaatgttatacaatcat
gatagtaaaaaagttaataaaaaagtaagagaagcactagatatgattattaatcgaaaa
gacattgctaaaaatatttctaaaaattatgctgagccagcatcaggtccttttaaccat
cgattaaaatcattagaaaaagaggaaattcaatcacaagacatcaagcgtgcaaaagaa
cttttagctcaagaaggttattccaaatcacatcctcttaaattaaacatggtcacatac
gatggcagaccagaattgcctaaaattggacaggtgatacaatctgaagctaaaaaggca
aatgttgatatacaattacgcaatgtagatgatatcgaaggatatctcaaaaacaaacag
ggttgggatgtttcaatgtatagttatttaagtgtgccacgtggtgatacaggttatttc
tttaacactgcatacttacctgatggagcattaaataaaggtaattatagtaatactaaa
gtcactcagttaattaaagaattaaatactactttcggtgacaagcaacgtggtcaagtg
actaatgaaatactaaatgaatctaaaaaagatattcctaacagctatatcacatacaac
tctcaaatagatggtgtgaataataaagtaagacattttaatgttacaccagaatctatc
tatttaattgattataaattaagtaaaaaagaataa

DBGET integrated database retrieval system