KEGG   Staphylococcus epidermidis ATCC 12228: SE1981Help
Entry
SE1981            CDS       T00110                                 

Definition
nickel ABC transporter nickel-binding protein
Orthology
K02035  
peptide/nickel transport system substrate-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
Peptides/nickel transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2017879..2019354
Genome map
AA seq 491 aa AA seqDB search
MKKLITLIVMISFVLASCGGTSSTDKDTLNVEIPLKTKSIAPYETDIPVKTGALESLFKM
SKNGKVKPLLVKNYHQVSDNQLELTLKDNIKFQNGHHLTGEAVKRSLEEGMKKSDLLKGS
LPIKSINAHGQKVTINTKEPYPELMSELASPFAAIYDTKAKNKVTDQPVGTGPYKIDQYK
RSQKIVLKQFKDYWQGTPKLKRINVTYHEDGNTRVDHLLSGKSDLTTDVPIERVDDVKKS
NKANIQSTSGFRTHLMLYNHDSKKVNKKVREALDMIINRKDIAKNISKNYAEPASGPFNH
RLKSLEKEEIQSQDIKRAKELLAQEGYSKSHPLKLNMVTYDGRPELPKIGQVIQSEAKKA
NVDIQLRNVDDIEGYLKNKQGWDVSMYSYLSVPRGDTGYFFNTAYLPDGALNKGNYSNTK
VTQLIKELNTTFGDKQRGQVTNEILNESKKDIPNSYITYNSQIDGVNNKVRHFNVTPESI
YLIDYKLSKKE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgattactcttattgtcatgatatcttttgttttagcgagctgtgggggc
acctcaagtacagacaaagacaccctcaatgttgaaatacctttgaaaactaaatcaatt
gcaccttacgaaactgatatcccagttaaaacaggtgccttggaatcgctttttaaaatg
tcgaagaatggtaaagtaaaacctttattagtcaaaaattatcatcaagtatctgacaat
caactagaactcactttaaaagataatattaaatttcaaaacggtcatcatttaacaggc
gaagctgtaaaacgcagtctcgaagaaggaatgaaaaaaagtgatttgttaaaaggatca
cttcctatcaaatcaatcaatgctcatggacaaaaagtcacaatcaatactaaagaacct
tatccagaattaatgtctgaactcgcaagcccatttgctgctatttacgacacaaaagct
aaaaacaaagtaactgatcaacctgttggtacgggtccttataaaattgatcagtataaa
cgttctcaaaaaatcgtactaaaacaattcaaagactactggcaaggtacgccaaaatta
aaaagaattaatgtcacttatcatgaagatggtaatactcgtgttgatcacttattatca
ggcaaatcagatttgactactgatgttccaattgaacgcgttgatgatgtaaaaaaatct
aacaaagcaaacattcaaagtacatcaggctttagaacgcatttaatgttatacaatcat
gatagtaaaaaagttaataaaaaagtaagagaagcactagatatgattattaatcgaaaa
gacattgctaaaaatatttctaaaaattatgctgagccagcatcaggtccttttaaccat
cgattaaaatcattagaaaaagaggaaattcaatcacaagacatcaagcgtgcaaaagaa
cttttagctcaagaaggttattccaaatcacatcctcttaaattaaacatggtcacatac
gatggcagaccagaattgcctaaaattggacaggtgatacaatctgaagctaaaaaggca
aatgttgatatacaattacgcaatgtagatgatatcgaaggatatctcaaaaacaaacag
ggttgggatgtttcaatgtatagttatttaagtgtgccacgtggtgatacaggttatttc
tttaacactgcatacttacctgatggagcattaaataaaggtaattatagtaatactaaa
gtcactcagttaattaaagaattaaatactactttcggtgacaagcaacgtggtcaagtg
actaatgaaatactaaatgaatctaaaaaagatattcctaacagctatatcacatacaac
tctcaaatagatggtgtgaataataaagtaagacattttaatgttacaccagaatctatc
tatttaattgattataaattaagtaaaaaagaataa

DBGET integrated database retrieval system