KEGG   Staphylococcus epidermidis ATCC 12228: SE1991Help
Entry
SE1991            CDS       T00110                                 

Definition
(RefSeq) ABC transporter ATP binding subunit
  KO
K10010  cystine transport system ATP-binding protein [EC:3.6.3.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02010  ABC transporters
Module
sep_M00234  Cystine transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE1991
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SE1991
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    SE1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_22 AAA_15 AAA_16 AAA_14 ABC_ATPase AAA_24 RsgA_GTPase PduV-EutP AAA_30 NB-ARC ATPase_2 G-alpha MobB NACHT AAA_25 AAA_23 AAA_19 TsaE AAA_5 cobW AAA_33 AAA_18 PRK RNA_helicase AAA_28
Motif
Other DBs
NCBI-GeneID: 1057825
NCBI-ProteinID: NP_765546
UniProt: A0A0H2VI58
Position
complement(2027692..2028423)
Genome map
AA seq 243 aa AA seqDB search
MIELSHIHKSFNETEVIKGIDLKVNQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
NGMTYNAKDKKSQIKVRQQSGMVFQNYNLFPHKSALENVMEGLITVKKMNKATANEEAMN
LLAKVGLVHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
KELADEGMTMVIVTHEMRFAKEVSNQIAFIHEGVIAEQGTPEDIFNHPKTEELQRFLNVI
NEK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgattgaattgtctcatatccataagtcttttaatgaaactgaagtgattaaaggtatt
gatttgaaagttaatcaaggtgaagttgtgacactaattggacgttcaggttcaggtaaa
acgactttacttagaatgattaatgctttagagatacctactgaaggtacagtgtatgtc
aatggcatgacatataatgctaaagataagaaatctcaaattaaagtaagacaacaatca
ggaatggtttttcaaaattataatttatttccacataaatctgcattagaaaacgttatg
gaaggtcttataacagttaaaaagatgaataaagcaacggctaatgaagaagcaatgaat
ttattggccaaggttggattggtacatgttaaagatcaacggccacatgctttatcaggt
gggcaacaacaacgtgtcgcaattgcacgtgcattagccatgaatcctaaagtgatgtta
tttgatgagccaacatctgcacttgatcctgaattggtcaatgatgtattaaaagtcatt
aaagaattggctgacgaaggtatgacaatggtcattgtgactcacgagatgcgttttgcc
aaagaagtttccaatcaaattgcttttattcatgagggcgtcattgcagaacaaggtacg
cctgaagatatatttaatcaccccaaaacagaagagcttcagcgatttttaaatgtgatt
aatgaaaaatag

DBGET integrated database retrieval system