KEGG   Staphylococcus epidermidis ATCC 12228: SE1991Help
Entry
SE1991            CDS       T00110                                 

Definition
ABC transporter ATP binding subunit
Orthology
K10010  
cystine transport system ATP-binding protein [EC:3.6.3.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Cystine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2027692..2028423)
Genome map
AA seq 243 aa AA seqDB search
MIELSHIHKSFNETEVIKGIDLKVNQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
NGMTYNAKDKKSQIKVRQQSGMVFQNYNLFPHKSALENVMEGLITVKKMNKATANEEAMN
LLAKVGLVHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
KELADEGMTMVIVTHEMRFAKEVSNQIAFIHEGVIAEQGTPEDIFNHPKTEELQRFLNVI
NEK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgattgaattgtctcatatccataagtcttttaatgaaactgaagtgattaaaggtatt
gatttgaaagttaatcaaggtgaagttgtgacactaattggacgttcaggttcaggtaaa
acgactttacttagaatgattaatgctttagagatacctactgaaggtacagtgtatgtc
aatggcatgacatataatgctaaagataagaaatctcaaattaaagtaagacaacaatca
ggaatggtttttcaaaattataatttatttccacataaatctgcattagaaaacgttatg
gaaggtcttataacagttaaaaagatgaataaagcaacggctaatgaagaagcaatgaat
ttattggccaaggttggattggtacatgttaaagatcaacggccacatgctttatcaggt
gggcaacaacaacgtgtcgcaattgcacgtgcattagccatgaatcctaaagtgatgtta
tttgatgagccaacatctgcacttgatcctgaattggtcaatgatgtattaaaagtcatt
aaagaattggctgacgaaggtatgacaatggtcattgtgactcacgagatgcgttttgcc
aaagaagtttccaatcaaattgcttttattcatgagggcgtcattgcagaacaaggtacg
cctgaagatatatttaatcaccccaaaacagaagagcttcagcgatttttaaatgtgatt
aatgaaaaatag

DBGET integrated database retrieval system