KEGG   Staphylococcus epidermidis ATCC 12228: SE2009Help
Entry
SE2009            CDS       T00110                                 

Definition
2-dehydropantoate 2-reductase (EC:1.1.1.169)
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SE2009
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     SE2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046439..2047371)
Genome map
AA seq 310 aa AA seqDB search
MKIAIAGSGALGSGFGAKLFQHGYDVTLIDNWEPQVTTIQQDGLHIDINGEAHHFRLPMY
RLTEIPKATSYDIVFLFPKSMQLEEVLSHIQPHLHDNTIVVCTMNGLKHERLIQQYVSID
RIVRGVTTWTAGIDQPGHTHLMGQGPVEIGCLVPEGKESVDIIVNLLQNAELKGVKSEHL
HQSIWKKICVNGTANSLCTILECNLAALNNSDDAKNLIYKITQEIVHVATVDDVHLNVDE
IFDYLIALNDKVGPHYPSMYQDLIKDNRTTEIDYINGAVSKLGKENHIATPVNDFVTNLV
HAKENQRGAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaattgcaggttctggcgcattaggtagtggatttggtgctaagttgttt
caacatggttatgacgtcactttaattgataattgggaacctcaagttactacaatacaa
caggacggtctacatatcgatattaatggtgaagcgcatcatttcaggctacctatgtat
agactaacggaaattcctaaagcaacgtcctatgatattgtttttctatttcctaaatct
atgcaattagaagaggtgcttagtcatattcaaccccatcttcatgataatacaattgtt
gtgtgcactatgaatggtttgaaacatgaacgtcttatacaacaatatgtttctatagat
agaattgtacgtggagtaacaacgtggactgccggtattgatcaacctggtcacacgcac
ttaatggggcaaggtcctgttgaaattgggtgtctcgtgcccgagggaaaagaaagcgta
gatatcattgttaatctgctacaaaatgcagaattaaaaggtgtaaaaagtgaacattta
catcaatcaatttggaagaaaatatgtgttaatggaacagctaattcattatgtactata
cttgaatgtaatttggcagcactgaataatagtgatgacgctaaaaatttgatatataaa
attacacaagaaattgttcatgttgcaacagttgatgatgttcatcttaatgttgatgag
atttttgattacttaattgctttaaatgataaagtaggcccacactatccttctatgtac
caagacttaattaaagataatcgaacaactgaaatagattatattaatggagcagttagt
aaattagggaaagagaatcatattgctacacctgtaaatgattttgtaacaaatcttgta
catgctaaagaaaatcaacgtggtgcacaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system