KEGG   Staphylococcus epidermidis ATCC 12228: SE2012Help
Entry
SE2012            CDS       T00110                                 

Definition
two-component response regulator
Orthology
K07705  
two-component system, LytT family, response regulator LytT
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Two-component system
Module
LytS-LytR two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SE2012
Two-component system [BR:sep02022]
 LytT family
  LysS-LysR
   SE2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2051375..2052133
Genome map
AA seq 252 aa AA seqDB search
MKALIVDDEPLARNELQYLLNLNDAIDEIEEAENIEETLEKLLYNTFDLIFLDINLMDES
GIDLAQKINKMKRSPHIIFATAHEKFAVKAFELNATDYILKPFEKERINQAVNKVDMAKD
KSKNKDKTITPKYIDYSDDERAQTHVLPIEVDERIHILNFTDIIALSVNNGITTIDTTKQ
SYETTETLNHYEKKLPSSLFIKIHRATIVNKEHIQTIEHWFNYTYQLTLTHEFKYQVSRS
YMKTFKQQLGLQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttaatcgttgatgatgaaccacttgcaagaaatgaattacaatatctttta
aatcttaatgatgctatagatgaaattgaagaagcagaaaacatagaagaaacattggag
aagttactctacaacacatttgacttaatattcttagatataaatttaatggatgaaagt
ggtattgatttagctcaaaaaattaataaaatgaagcgatcaccacatattatctttgca
accgctcacgagaaatttgcagtcaaagcctttgaattaaatgcaaccgattatatatta
aaaccttttgaaaaagaacgtattaatcaagctgtaaataaggttgacatggctaaagat
aaatcaaaaaacaaagataaaactatcacacctaaatatattgattatagtgatgatgag
cgcgctcaaacacatgtactcccaattgaagtggatgaacgtattcacatcttaaatttc
acagacattatcgcattatctgttaataatgggattacaacgatagatacaacaaaacaa
agttatgaaacgaccgaaacacttaatcattacgagaaaaaactaccttcctctctattt
attaaaatacatcgcgctactatcgttaataaagaacatatccaaacaatagagcattgg
tttaattatacgtatcagctgacgttaacacatgaatttaaatatcaagttagtcgttct
tatatgaagacttttaaacaacaacttggtcttcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system