KEGG   Staphylococcus epidermidis ATCC 12228: SE2018Help
Entry
SE2018            CDS       T00110                                 

Definition
glycine betaine/carnitine/choline ABC transporter ATP-binding opuCA
Orthology
K05847  
osmoprotectant transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2055907..2057163)
Genome map
AA seq 418 aa AA seqDB search
MLSIKNLTKIYSGNKKAVDNISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATDGQIM
MNGKDVRNMNPVELRRSIGYVIQQIGLMPHMTIRENIVLVPKLLKWSKEKKDEKAKELIK
LVDLPEEYLDRYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKE
LQQKLGKTFIFVTHDMDEAIKLADKICIMSKGKVVQYDTPDNILRYPANDFVRDFIGQNR
LIQDRPNMKSVESAMIKPVTVKADDSLNDAVNIMRTRRVDTIFVVNNQNKLLGFLDIEDI
NQGLRARKELIDTMQRDVYKVHINSKLQDSVRTILKRNVRNVPVVDNDEHLIGLITRANL
VDIVYDSIWGEEDSDSYEIPNESLDENNHDLPQNQTDTRTNINEDVNDYHDAQHRGED
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtattaaaaacttaaccaagatttattcagggaataaaaaagcggtagataat
atttctttggatattcaatctggtgaatttatcgcttttattgggacgagtggtagtggt
aaaacaactgcactacgcatgattaatcgtatgattgaggcgacagatggacagattatg
atgaatggaaaagatgtccgtaatatgaatcctgttgaattgcggagaagtatcggttat
gtcattcaacaaattggtttgatgccacatatgactattcgagaaaatattgttttagta
cctaaacttttaaaatggtctaaagagaagaaagatgaaaaagctaaagaacttattaaa
ctggtagatttacctgaagaatatttggatcgttatccagctgaattgtcaggagggcaa
caacaacgaattggtgttgtgcgcgctttagcagctgaacaagatattatattaatggat
gaacctttcggtgcattagatcctattacacgcgatacattacaagatttagtaaaggaa
ttacaacaaaaattaggaaaaacatttatttttgtcactcatgatatggatgaggctatt
aaattagcagacaaaatatgtattatgtctaagggaaaagtcgttcaatacgatacacct
gacaatattttacgatatcctgcaaatgactttgttagagattttattgggcaaaatcgc
ttgattcaggatcgtcctaatatgaaatctgtggaaagtgctatgatcaaacccgtcact
gttaaagcagatgattcattgaatgatgcagtaaatattatgagaacacgtcgagtagac
actatttttgtagtcaataatcaaaataaattattaggatttttagatattgaagatatc
aatcaaggattacgtgcgcgtaaagaattaattgataccatgcaaagggatgtctacaaa
gtacatatcaattcaaagttacaagactcagtgcgtactattctaaaacgtaatgttaga
aatgtccctgtggtcgataatgatgaacatctcattggtttaattacacgtgcaaactta
gtcgatattgtgtatgactcaatttggggcgaagaagattctgatagttatgagatccca
aatgaaagcttagatgagaataatcacgatttaccacaaaatcaaactgatacacgaaca
aatataaatgaagatgtgaatgattatcatgatgctcaacatagaggtgaggattaa

DBGET integrated database retrieval system