KEGG   Staphylococcus epidermidis ATCC 12228: SE2025Help
Entry
SE2025            CDS       T00110                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02068  putative ABC transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
sep_M00211  Putative ABC transport system
Brite
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative ABC transporter [MD:M00211] [OT]
    SE2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_22 RsgA_GTPase AAA_15 AAA_18 AAA_16 G-alpha ABC_ATPase AAA_30 NACHT AAA_5 AAA_23 AAA_14 AAA_33 AAA_24 RNA_helicase AAA_28 SbcCD_C Cytidylate_kin AAA_25 NB-ARC T2SSE PIF1 IstB_IS21 MMR_HSR1 AAA Adeno_IVa2 Mg_chelatase ATPase_2 PRK NTPase_1 cobW ATP_bind_1 PSD3 PTPS_related
Motif
Other DBs
NCBI-GeneID: 1057775
NCBI-ProteinID: NP_765580
UniProt: A0A0H2VJC3
Position
complement(2064825..2065496)
Genome map
AA seq 223 aa AA seqDB search
MFKLLLKVEHLTYKVDNRTILDDINLNINKGDTIAIVGPSGSGKSTLLKQLNHLISPTSG
DLYLNDQSYFNYKPEEIRTRVSYLMQQSELIGYTIEDNMKFPAEARSEAFDRDKAKQLIS
QVGLGNYQLDAQIEHMSGGEQQRITIARQLMYEPEVLLLDEATSALDTHNKKKIEEIIFK
LADKGIAILWITHSDDQSMRHFKRRITITDGKISSDEELNGNE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaattgctacttaaggttgaacatcttacatacaaggttgataatcgtacgatt
ttagatgatattaatttgaatattaataaaggagacacgattgctattgtaggtccttct
ggaagcggtaagagtactttactcaaacaattgaatcatttaattagtcccacgagtgga
gatttatatttgaatgatcaatcttactttaattataagccggaagagataagaacacgt
gtgagttatttaatgcaacaaagtgagttaatcggttatacaattgaagataatatgaaa
tttcctgctgaggctagaagtgaagcttttgaccgtgataaagcgaaacaactcatctct
caagtaggattaggtaattatcagttagatgctcaaattgagcacatgtctgggggagag
caacaacgtattaccatagctagacaactcatgtatgaacctgaagttttattattggac
gaagctactagcgctttagatacacataataaaaagaaaattgaagaaattatatttaaa
ctagcagataaagggattgccattttgtggattacgcatagtgatgaccaaagtatgcgt
cattttaagcgtagaatcacaattactgacggtaagatatcgagtgatgaggagttgaat
ggtaatgagtaa

DBGET integrated database retrieval system