KEGG   Staphylococcus epidermidis ATCC 12228: SE2068Help
Entry
SE2068            CDS       T00110                                 

Definition
Zn-binding lipoprotein adcA
Orthology
K09815  
zinc transport system substrate-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Zinc transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2113332..2114261)
Genome map
AA seq 309 aa AA seqDB search
MSIIILMLSGCSSFDHRKRESINDKNKMKVYTTVYAFQSLTQQIGGKYVDVQSIYPDGAD
LHSYEPTQKDMIDIAKSDLFVYSSHQLDPVAAKITNSMTNNSMKLALAEGLKQSDFIDSK
GHDEDHEHHSHHEESNQDPHVWLDPVLNQKFAFMIKEKLIEKDPKHQAYYNKNYKMVNKD
IVHIDQQLQSITKHSKRDKVVISHDSLGYLAHRYGFKQQGVKGMNDEEPSQKEILNIVKD
IQHSHAPYVLYEQNITSKITDVIKKETDTKPLSFHNLAVLTKEEQNDDSISYQSLMKKNI
YVLNRALNN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaatcatcattttaatgttaagcggatgcagtagctttgatcatcgtaaacgcgaa
agtattaatgacaagaataaaatgaaagtatacacgactgtatacgcatttcaaagtttg
acacaacagattggcggaaaatatgttgacgtgcaatcaatctatcctgatggtgcagat
ttacactcatatgaaccaacacaaaaagatatgattgatattgccaaaagtgatctgttt
gtctattcaagccatcaattagatcctgtcgctgcaaagattacgaattcgatgaccaat
aatagtatgaaattagcgcttgccgaaggactcaaacaaagtgattttattgactctaaa
ggccatgatgaagatcacgagcatcattcacatcatgaagaatcgaatcaagatcctcat
gtttggttagatcctgttctaaatcaaaaattcgctttcatgatcaaagagaaattaata
gagaaagaccctaaacatcaagcttattacaataaaaattataaaatggtaaataaagat
attgtgcatattgatcaacaactacaatcaataacgaagcattctaaaagggataaagtt
gtgatttcacatgattcgcttggatatttagcgcatcgttatggttttaaacaacaaggt
gttaaaggtatgaatgatgaagaacctagtcaaaaagagattttgaatatcgttaaagat
attcaacattcgcatgcgccttatgttttatatgaacaaaatattacctccaaaattaca
gatgttattaagaaagaaacagatacgaaaccattaagttttcataatctagctgtattg
actaaagaggagcaaaatgatgattcaatttcataccaatcattaatgaaaaagaacatt
tacgtattaaatcgcgcactcaataattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system