KEGG   Staphylococcus epidermidis ATCC 12228: SE2106Help
Entry
SE2106            CDS       T00110                                 

Definition
(RefSeq) transcription regulator
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 1057304
NCBI-ProteinID: NP_765661
UniProt: A0A0H2VJK5
Position
complement(2150033..2150917)
Genome map
AA seq 294 aa AA seqDB search
MDIKHMKYFVEVVKQGGMTNASKSLYIAQPTISKAIKDIEAEMAVPLFDRSKRSLVLTDA
GKIFFKKCQEIIALYDNLPTEINSLYGLETGHITISMSAVMSMRKFIGVLGDFHQLYPNI
TYNLIESGGKTTENLILNDEVDIGVTTLPVDHQKFECISLNKEELTVVLNKEHPLAQKSS
IKMEELADENFILFNEDFYLNDKIIENAKNAGFVPNMASQISQWNVIENLVINQLGISIL
PATIAQLLNDDVKIVHLENAHTTWELGVVWKKDKRLSHATNKWIEFLKERLSEE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaacacatgaaatactttgttgaagttgtcaaacaaggtggtatgacaaac
gcttcaaaatccttgtatattgcgcaaccaactatcagtaaagcaattaaggatattgaa
gcagagatggctgtccctttatttgaccggagtaaaagaagtttagtacttactgatgca
ggtaaaatttttttcaagaaatgtcaagaaatcatcgcactatatgataatttgcccact
gaaattaatagtttgtatggtttagaaacaggtcatatcactattagtatgtctgcagtg
atgagcatgcgtaaatttattggcgtattaggagactttcatcaactttatccgaatatc
acgtacaacttaatcgaaagtggtggtaagacgactgaaaaccttatacttaatgatgaa
gtggatattggtgtgacaacattgccagtagatcatcaaaaatttgaatgtatatcttta
aacaaagaagaactgactgtagttttaaataaagaacatcctttagcacaaaaatcttct
attaaaatggaagaattagctgatgagaacttcattttatttaatgaagatttctatctc
aacgataaaattattgaaaatgcgaagaatgctggattcgtgccgaacatggcctcacaa
atctcacaatggaatgtgattgaaaatcttgtcattaatcaattaggtatttccatattg
ccagccactatagcacaattacttaatgatgacgtcaaaattgtacatttggaaaatgca
catacaacttgggagcttggtgtcgtttggaaaaaagataaacgtttaagtcatgctaca
aataaatggatagaatttttgaaagaaagattatccgaagaataa

DBGET integrated database retrieval system