KEGG   Staphylococcus epidermidis ATCC 12228: SE2110Help
Entry
SE2110            CDS       T00110                                 

Definition
3-hydroxy-3-methylglutaryl-CoA synthase
Orthology
K01641  
hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SE2110
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SE2110
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SE2110
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SE2110
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SE2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2153608..2154774
Genome map
AA seq 388 aa AA seqDB search
MNIGIDKISFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMTVSPVNQDIVSMGANAAK
DIITEEDKKNIGMVIVATESAIDNAKAAAVQIHHLLGIQPFARCFEMKEACYAATPAIQL
AKDYLAQRPNEKVLVIASDTARYGIHSGGEPTQGAGAVAMMISHNPSILKLNDDAVAYTE
DVYDFWRPTGHQYPLVAGALSKDAYIKSFQESWNEYARRHNKTLADFASLCFHVPFTKMG
QKALDSIINHADETTQDRLNSSYQDAVDYNRYVGNIYTGSLYLSLISLLETRDLKGGQTI
GLFSYGSGSVGEFFSGTLVDGFKEQLDVERHKSLLNNRIEVSVDEYEHFFKRFDQLELNH
ELEKSNADRDIFYLKSIDNNIREYHIAE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatataggtatagataaaataagtttctatgtacccaaatattatgtagacatggct
aaacttgcagaagcgcgccaagtcgatcctaataaatttttaattggaattggtcaaact
gaaatgactgtgagcccagtgaatcaagatatcgtatctatgggagccaatgctgctaaa
gatattataacagaagaagataaaaagaatattggtatggttatagtagcaactgagtct
gcgattgataatgccaaagcagcagccgttcaaattcaccatcttttaggtattcaaccc
tttgcaagatgctttgaaatgaaagaggcttgttatgcagcaacacctgcaattcaactt
gccaaagattatcttgctcaacgccctaacgaaaaggttcttgtcattgctagtgacaca
gctcgttatggtattcattctggtggtgagcctactcaaggtgccggtgcagttgcaatg
atgatttcacataacccaagtattttaaaacttaatgatgatgccgtagcatatactgaa
gacgtttatgatttctggcgtccaacgggtcatcaatatcccttagttgctggtgcattg
tcgaaagatgcctatatcaagtcattccaagaaagttggaatgaatatgcacgtcgccat
aataaaacactcgctgatttcgcttcactatgtttccatgtaccattcaccaaaatggga
caaaaagctttagattctattattaatcatgccgatgaaactacacaagaccgtcttaac
tctagttaccaagatgcagttgattataatcgttatgtcggtaatatttacacagggtcc
ttatatttaagtctcatctctttattagaaacacgtgatttaaaaggcggacaaacgatt
ggtctctttagttatggttctggttctgtaggcgagttctttagtggaacattagtagat
ggattcaaggagcaattagatgttgagcgccacaaatctttattaaataatagaatagag
gtttctgttgatgaatatgaacatttcttcaaacgctttgaccaattagaattgaatcat
gaacttgaaaaatcaaatgcagatcgtgacattttctatttaaaatctattgataacaat
attcgtgaatatcatatagcagaataa

DBGET integrated database retrieval system