KEGG   Staphylococcus epidermidis ATCC 12228: SE2110Help
Entry
SE2110            CDS       T00110                                 

Definition
3-hydroxy-3-methylglutaryl-CoA synthase
Orthology
K01641  
hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sep00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sep00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sep00280]
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sep00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2153608..2154774
Genome map
AA seq 388 aa AA seqDB search
MNIGIDKISFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMTVSPVNQDIVSMGANAAK
DIITEEDKKNIGMVIVATESAIDNAKAAAVQIHHLLGIQPFARCFEMKEACYAATPAIQL
AKDYLAQRPNEKVLVIASDTARYGIHSGGEPTQGAGAVAMMISHNPSILKLNDDAVAYTE
DVYDFWRPTGHQYPLVAGALSKDAYIKSFQESWNEYARRHNKTLADFASLCFHVPFTKMG
QKALDSIINHADETTQDRLNSSYQDAVDYNRYVGNIYTGSLYLSLISLLETRDLKGGQTI
GLFSYGSGSVGEFFSGTLVDGFKEQLDVERHKSLLNNRIEVSVDEYEHFFKRFDQLELNH
ELEKSNADRDIFYLKSIDNNIREYHIAE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatataggtatagataaaataagtttctatgtacccaaatattatgtagacatggct
aaacttgcagaagcgcgccaagtcgatcctaataaatttttaattggaattggtcaaact
gaaatgactgtgagcccagtgaatcaagatatcgtatctatgggagccaatgctgctaaa
gatattataacagaagaagataaaaagaatattggtatggttatagtagcaactgagtct
gcgattgataatgccaaagcagcagccgttcaaattcaccatcttttaggtattcaaccc
tttgcaagatgctttgaaatgaaagaggcttgttatgcagcaacacctgcaattcaactt
gccaaagattatcttgctcaacgccctaacgaaaaggttcttgtcattgctagtgacaca
gctcgttatggtattcattctggtggtgagcctactcaaggtgccggtgcagttgcaatg
atgatttcacataacccaagtattttaaaacttaatgatgatgccgtagcatatactgaa
gacgtttatgatttctggcgtccaacgggtcatcaatatcccttagttgctggtgcattg
tcgaaagatgcctatatcaagtcattccaagaaagttggaatgaatatgcacgtcgccat
aataaaacactcgctgatttcgcttcactatgtttccatgtaccattcaccaaaatggga
caaaaagctttagattctattattaatcatgccgatgaaactacacaagaccgtcttaac
tctagttaccaagatgcagttgattataatcgttatgtcggtaatatttacacagggtcc
ttatatttaagtctcatctctttattagaaacacgtgatttaaaaggcggacaaacgatt
ggtctctttagttatggttctggttctgtaggcgagttctttagtggaacattagtagat
ggattcaaggagcaattagatgttgagcgccacaaatctttattaaataatagaatagag
gtttctgttgatgaatatgaacatttcttcaaacgctttgaccaattagaattgaatcat
gaacttgaaaaatcaaatgcagatcgtgacattttctatttaaaatctattgataacaat
attcgtgaatatcatatagcagaataa

DBGET integrated database retrieval system