KEGG   Staphylococcus epidermidis ATCC 12228: SE2119Help
Entry
SE2119            CDS       T00110                                 

Definition
copper-transporting ATPase copA
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2162776..2165160
Genome map
AA seq 794 aa AA seqDB search
MANTTLTLDIIGMTCAACSNRIEKKLNRMNHVQAKVNLTTEKATIDYESDDYHLEDFVEQ
IQSLGYDVAVEQVELNINGMTCAACSNRIEKVLNQTQGVQQATVNLTTEQALIKYYPSAT
NTEALIKRIQNIGYDAETKTSSKAQSNRKKQELKHKRNKLIISAILSLPLLLVMVVHISP
ISIPSILVNPWVQLILSTPVQFIIGWQFYVGAYKNLRNGSANMDVLVAVGTSAAYFYSIY
EMMMWLTHQTHHPHLYFETSAILITLILLGKYLEARAKSQTTNALSELLNLQAKEARVIK
ENKEIMLPLDKVKVGDTLLIKPGEKIPVDGKVTKGDTSIDESMLTGESIPVEKSSGDSVI
GSTMNKNGSIMIEATQVGGDTALSHIIKVVEDAQSSKAPIQRLADIISGYFVPIVVSIAV
ITFIIWIIFVHPGQFEPALVSAISVLVIACPCALGLATPTSIMVGTGRAAENGILFKGGQ
FVERAHYVDTIVLDKTGTITNGQPVVTDYVGDNDTLQLLASAENASEHPLADAIVTYAKD
KGLNLLDNDTFKSIPGHGIKATIHQQQILVGNRKLMNDYNISISNKLNDQLNHYEHLGQT
AMMIAVDNQINGIIAVADTVKNDAKQAIKELRNMNIDVVMLTGDNNRTAQTIAKQVGIEH
VIAEVLPEEKAHQISLLQDKGKQVAMVGDGINDAPALVKADIGMAIGTGAEVAIEAADIT
ILGGDLLLVPKAIKASKATIKNIRQNLFWAFGYNVAGIPIAACGLLAPWIAGAAMALSSV
SVVMNALRLKKMKL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatacaacgttgactttggatattattggtatgacatgtgctgcgtgctcaaat
cgtattgaaaagaaattgaatcgtatgaatcatgttcaagctaaagtgaatctgactact
gaaaaagcaactatcgactatgagtctgacgattatcatctcgaagattttgtagagcaa
attcaaagtctcggctatgatgttgcagttgagcaagtagaattaaatataaatggtatg
acatgtgctgcatgttctaatcgtatagaaaaggttctaaatcaaacgcaaggtgtacaa
caggcaacagtaaacttaactaccgaacaagcactcatcaaatattaccctagtgctacg
aacacggaagcattaattaagcgtattcaaaatattggatacgatgctgaaactaaaact
tcatcaaaagcgcaatcaaatcgtaaaaaacaagagttaaaacataaacgcaataaatta
atcatttcagctattttatcgttgccactattattagtaatggtggtgcatatctcacca
atttccattccatccattttggtcaatccttgggtacaattaattctttcaacacctgtc
caatttattattgggtggcaattttacgttggcgcgtataaaaatttgcgaaatggttca
gctaacatggatgtattggttgctgttggtaccagtgccgcatatttttatagcatttat
gaaatgatgatgtggctcacacatcaaacacatcacccgcatttatattttgaaacaagt
gctattttaattacgttaattcttcttggtaaatatttagaagcacgtgccaaatcacag
actaccaatgcattaagcgaattgttaaatttacaagcgaaagaagcacgagtaattaaa
gaaaataaagaaattatgcttccacttgataaagttaaagtcggagatactttactaata
aaacccggcgaaaagatacctgtagatggcaaagtcactaaaggtgatacttctattgac
gaatccatgctaactggtgagtctatacctgttgaaaaaagtagtggcgattcagtgatt
ggttctaccatgaataaaaatggttcaatcatgattgaagcaactcaagtaggtggtgat
actgcattatcacatataattaaagtggttgaggatgctcaaagttctaaagcaccgatt
caacgcttagctgatattatttctggatattttgttccgattgtagttagcattgcggtt
attacttttatcatatggattatattcgttcaccccgggcaatttgaacctgcacttgtt
tcagcaatatctgttttagttattgcttgtccctgtgcacttggtttagcaacgcctaca
tctattatggtaggtacaggacgtgctgcagaaaatggcatattattcaaaggaggccaa
tttgtagaacgtgcacattatgttgatacaatcgtgctagataaaacaggcacaattact
aatggtcaacctgtagtaactgattatgttggtgacaatgatacattacaacttttagca
agtgctgaaaatgcttcagaacatcctcttgctgatgctattgttacttatgctaaagat
aaaggtcttaatttacttgataatgacacttttaaatcaattccgggacatggtattaaa
gctacgattcatcaacaacaaatccttgtgggcaatcgaaaattaatgaacgattacaat
atatctattagtaataaattaaatgaccaattaaatcactatgaacatttaggtcaaacg
gcaatgatgattgccgtggataatcaaattaatggaatcattgctgttgctgatacagta
aaaaatgatgctaaacaagcgataaaagaactaagaaatatgaatatcgacgtggttatg
ctgactggtgataacaatcgaacagctcaaaccatcgccaaacaagttggcattgaacat
gtaattgcagaagtgttgcccgaagaaaaggcacatcaaatctctttattacaagacaaa
ggtaaacaggttgccatggtcggtgatggaattaatgatgcgcctgcacttgtaaaagcc
gatattggaatggctataggcactggagctgaggtagcgattgaagctgcagatattacg
attcttggtggtgacttgctattagttccaaaagctatcaaagcaagtaaagctacgatt
aaaaatattcgacaaaatttattttgggcatttggatataacgtagctggcatcccaata
gctgcttgtggtttattagcaccttggattgccggtgctgctatggcattaagttctgtt
agcgtagttatgaatgcattaagactgaaaaaaatgaaactatag

DBGET integrated database retrieval system