KEGG   Staphylococcus epidermidis ATCC 12228: SE2154Help
Entry
SE2154            CDS       T00110                                 

Definition
coenzyme A disulfide reductase
Orthology
K00359  
NADH oxidase [EC:1.6.-.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.-  Acting on NADH or NADPH
    1.6.-.-  
     SE2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2199852..2201213
Genome map
AA seq 453 aa AA seqDB search
MKYIVVGTSHSGYEVIQTLLKEDENADIQVFESADQPSFLSCGIQSYLEDISSSLDDLHY
ASVDSYKAQGVNIHTNSTVTDLDTDNKTVVVEHQGQTATYSYDKLFLSPGGKPVTPPVDG
IEKYKHVLFMRGRDWANQIKERMKDAKKAVVVGGGYIGIEAAEAFAKADIDTTIVDVADR
ILNTYLDKEFTDILETNAQQHGLHFKGGETVKSISGNQNGEVTTVVTDKNEYDADTVLFA
VGVEPATEWLKDKIDLGKKGIININHQQQTSAKDVYAGGDATLVPFAPVSEDRYIALATN
SRRQGVVAAKNMLGKEMTMPRVSGTSGLQLFDYKFGQTGIHGTEIDNYDGNLGQTYVEEL
IRPQFMQDDTKIHMKIIYDKDTHRILGGQVMSKEDITASINTISVVISAGFTLEQLAVQD
FFFQPDYDRPWHYLNVLAQQALGDTFGSDKMLF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattgtggtaggtacatctcattcaggatatgaagtgatccaaacattgctt
aaagaagatgaaaatgctgatattcaagtttttgaaagtgcagatcaaccgtccttttta
tcttgtggtattcaaagttatcttgaagacatctcatcatcattagatgatttacattac
gcatcagttgactcttataaggcacaaggtgtaaatattcatacgaatagcacagtcaca
gatttagatactgacaataagactgttgtagttgaacaccaaggtcaaacagcaacttat
tcttatgataaattgttcctaagtcctggtggcaaacctgttacccctccagtcgatgga
attgaaaaatataaacatgtattatttatgcgtggacgtgattgggcaaatcaaattaaa
gaacgcatgaaagatgccaaaaaggctgttgtagtcggaggtggctatatcggtattgaa
gctgctgaagcttttgctaaagcagacatagatactacaatcgtagatgtcgctgatcgt
atattaaacacttacttagataaagaatttacagacatattagaaacaaatgcacagcaa
catggtcttcattttaaaggtggcgaaacagtaaaatcaatttcaggaaatcaaaatggc
gaagtaactactgtagttaccgacaaaaatgaatatgacgcagatactgtcttatttgct
gtaggtgtcgaaccagctaccgagtggctaaaagataaaattgatttaggtaagaaagga
attataaacattaaccaccaacaacaaacatctgctaaagatgtctatgcgggtggcgat
gcgacattagttccttttgcaccagtatctgaggatcgttatattgcattagcaacaaat
tcaagacgtcaaggcgttgtcgcagcaaaaaacatgttgggtaaagaaatgacaatgcca
cgcgtttctggtacttcaggtttacaattatttgattataaatttggacaaactggcatt
cacggtacagaaatcgataattatgatggcaatttaggtcaaacatacgtagaagaattg
attcgtcctcagtttatgcaagatgatacgaaaattcatatgaaaattatttatgataaa
gacactcaccgtatacttggtggtcaagtcatgtcaaaagaagatattactgcttctatt
aacacaatttcagtagtaatatctgctggtttcacacttgaacagctcgctgtccaagat
ttcttcttccaacctgattatgatagaccttggcattatcttaatgtgttagcccaacaa
gcattgggagatacatttggtagcgataagatgttattctaa

DBGET integrated database retrieval system