KEGG   Staphylococcus epidermidis ATCC 12228: SE2160Help
Entry
SE2160            CDS       T00110                                 

Definition
pyruvate phosphate dikinase (EC:2.7.9.1)
Orthology
K01006  
pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE2160
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SE2160
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     SE2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2206387..2209014)
Genome map
AA seq 875 aa AA seqDB search
MTQFVYAFNEGNIAMKDLLGGKGANLSEMKRLGLPVPDGFTITTEACITYLKQNEELPTE
VKTQLIDHLAAFSKRTGKAFSSDDNLLLVSVRSGAKISMPGMMDTILNLGLNDDNVKKLV
DKTNDARFAYDCYRRLLQMFGEVVYGIPMTAFDTYFNDFKTKHRYQNDAEIPAEGLQTIC
EKYKEIYVEEAYKPFPQEPLKQLEEAIEAVFKSWDNDRARVYRDLNDIPHDIGTAVNIQE
MVFGNSGENSGTGVAFTRNPVTGENHLFGEYLLNAQGEDVVAGIRTPKDIDTLKQQMPDV
HQEFVDVTKQLEKHYKDMQDIEFTIENGKLYLLQTRNGKRTAKAAIKIAVDLVHEQLITR
EEAVSKVEVKSIDQLLHPNFNEESLKQATVVSKMGLPASPGAATGKVVFSAEEAKLQAEN
GNKVVLMRPETSPEDIEGMVASEAIVTTHGGMTSHAAVVARGMGKCCVTGCSNVEIDTVN
KTVYYPEGELHEGDIVSVDGSAGDLYLGAIETVNAEHSEEFDQFMTWSEEIARLQVRMNA
ETPQDIKAGYNFGSKGIGLVRTEHMFFGPERLIEMRRFILASNHDERVQALEKIKTYQVE
DFETIFRLSQDRPTIVRLLDPPLHEFLPSSEEDINNVSQQLNVSSEFLRKRIVDLNEVNP
MLGHRGCRLAVTYPELYEMQVEAIIESVIKLQKEGITCLPEIMIPLVSTVEEFTTLKERL
VNTITHLEKESQQDIQYMIGTMIETPRACLIANDLAKHCDFFSFGTNDLTQLTFGFSRDD
AGKFINVYTENNILQLDPFQTLDREGVGRLIQLAVEQAKNTNPEIKIGVCGELGGDAKSI
RKFNQWEIDYVSCSPFRVPGAILATAQSQAEESER
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattcgtttatgcatttaatgaaggaaatatagctatgaaagacttacttggt
ggtaaaggtgccaatctttcagagatgaagagactcggactaccagtaccagatggtttt
acaattacgactgaagcttgtattacatatttaaaacaaaatgaagaactacctacagaa
gtaaagacacaattaattgatcatttagcagctttttctaaacgaacaggaaaagccttt
tcctctgatgataacttgttattagtatcagtacgtagtggtgcaaaaatttccatgcca
ggaatgatggatacaattcttaatttaggacttaatgatgataatgtaaaaaagcttgtt
gacaaaacaaatgatgcacgatttgcatatgattgttaccgtcgtttactacaaatgttt
ggagaggttgtttatggtattccaatgacagctttcgatacatattttaatgattttaaa
acaaagcatcgttatcaaaatgatgctgaaattccggcagaaggactacaaactatatgt
gaaaaatataaagaaatctatgtagaagaggcatataaaccttttccccaagaaccgtta
aagcaattagaagaagcaattgaagcagtatttaaatcttgggataatgatcgtgcacgt
gtatatagagatttaaatgatattccacatgatattggtacagccgtaaatattcaggaa
atggtatttggtaatagtggtgaaaatagtggtacgggtgtagcatttacaagaaatcca
gttactggagaaaatcatttattcggagagtacttacttaatgctcaaggtgaagatgtt
gttgcaggcattcgtacccctaaggatattgacactttaaaacaacaaatgccagatgta
catcaagagtttgttgatgtaaccaaacaacttgaaaaacattacaaagatatgcaagac
atagaatttacaattgaaaatggtaaactttatttattacaaacacgtaacggaaaacgt
actgctaaagctgcaataaaaattgctgtggatttagttcacgagcaattaattacacgt
gaagaagcagtatcaaaagtagaagtaaaatcaatagaccaattattacatcctaatttt
aatgaagaatcattaaagcaagcgacagtggtttctaaaatgggcttaccagctagtccc
ggtgcagcaacaggaaaagtagtcttctctgctgaagaagcaaaacttcaagctgaaaat
ggtaataaagtagtgttaatgcgaccggaaacatcacctgaagatattgaggggatggta
gcaagtgaagcaatcgtaacaactcatggtggtatgacatcacacgctgctgttgtagca
agaggaatgggcaaatgttgtgtgacaggatgttcgaatgtagagatagatacagtgaac
aaaacagtatattatcctgaaggtgaattacatgaaggggatatcgtttctgtagatggt
tcagctggtgatttatatttaggagcaattgaaacagtcaatgctgaacatagtgaagag
ttcgatcaatttatgacttggtctgaagagattgcaagactgcaagttagaatgaatgct
gaaacaccacaagatataaaagctggatataattttggttctaaaggaataggtttagtt
cgtactgagcacatgttctttggccctgaacgtttaatagaaatgcgccgttttatctta
gcttcaaatcatgacgaacgtgtacaagctttagaaaaaattaaaacataccaagtagaa
gattttgaaacaattttcagattatctcaagatagacctacgattgttcgtttacttgat
ccaccgttacatgagttcttaccatcatctgaagaagatataaacaatgtttctcaacag
ctgaatgtatcttcagagttcttacgcaagcgaatcgttgacttaaatgaggtcaatcca
atgcttggtcatcgtggttgtcgtttggctgtgacttatccagagttatatgagatgcaa
gttgaagctatcattgaaagtgttattaagcttcaaaaagagggcataacgtgcctacca
gaaattatgattcctctcgtgtcaacagtagaagaatttacaactttaaaagaacgatta
gttaatacaattacacatttagaaaaagaatcacaacaagatatacaatatatgataggt
actatgattgaaacgcctagagcatgcttgattgcgaatgaccttgcgaaacattgtgat
ttcttcagttttggtactaatgatttaacgcaattgacatttggtttctctagagatgat
gcaggaaaattcataaatgtgtatactgaaaataacattttacagcttgacccattccaa
actttagatagagaaggtgtaggacgactaattcaattagctgttgaacaagctaaaaat
acaaatccagagataaaaattggtgtatgtggtgagcttggtggcgatgcaaaatcaatt
cgtaaatttaaccaatgggaaattgattatgtttcatgttcaccatttagagttccgggt
gcaattttagctacagctcagagtcaagcggaggaaagcgagcgataa

DBGET integrated database retrieval system