KEGG   Staphylococcus epidermidis ATCC 12228: SE2163Help
Entry
SE2163            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2211768..2211986)
Genome map
AA seq 72 aa AA seqDB search
MSFYHFIQNFVGDETPLGKLATCINQDEDLPMEETTAHNILNYFNQLNYFDDDCIEAVKR
SLSLYEQSKVAL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttttatcattttatacaaaatttcgttggtgatgaaacacctctaggtaaacta
gccacatgtattaaccaagatgaagatttacctatggaagaaacaacagcacataatata
ttaaactattttaatcagttaaattattttgatgacgattgtattgaagctgtaaaacgc
tcactatcactatatgaacaaagtaaagtagccctataa

DBGET integrated database retrieval system