KEGG   Staphylococcus epidermidis ATCC 12228: SE2193Help
Entry
SE2193            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Orthology
K02003  
putative ABC transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
Putative ABC transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2244775..2245524)
Genome map
AA seq 249 aa AA seqDB search
MLLEVKNVKKVYGRGMNTTMALNQMNLEIDENEFVAIMGESGSGKSTLLNLIATFDRTTE
GLIKLDGLPLNQLKNKDIARFRREMMGFVFQDFNVLNTMSNKDNILMPLVLANERPKIMQ
KRLMEISEQLGIEDLLEKYPSEISGGQKQRIAIARALIARPKLLLADEPTGALDSKTSKN
LMCLFRKINQKHQTILMVTHSNIDASYANRVIFIKDGRLYHEIYRGEESQTDYQKRIADS
LAILNGVGD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgttattagaggttaaaaatgtaaaaaaagtctatggcagaggtatgaacacgacaatg
gctttaaatcaaatgaaccttgaaattgatgaaaatgaatttgtagcaatcatgggcgag
tcaggttcaggtaaatctacattactcaatttaattgctacttttgatcgtacaactgaa
ggattaataaagttagacgggttgccgcttaatcaattgaagaataaagacattgcacgc
tttcgcagagaaatgatgggatttgtgtttcaagattttaatgtgttgaatacgatgtcg
aacaaagataatattttgatgcctcttgtacttgcaaatgaacgtccgaaaataatgcaa
aaacgcttaatggaaataagtgaacaattaggaattgaagacttgcttgaaaaatatccg
tctgaaatatctgggggacaaaaacaacggatagctatagcccgtgcgttgatagcacga
cctaaattattattagctgatgaacccactggtgcacttgattcaaaaacctctaaaaac
cttatgtgtttatttcgaaaaattaatcaaaagcatcaaactatattaatggtgacacat
tcaaatattgacgcgtcatatgcgaaccgtgtcatcttcatcaaagatggtcgtttgtat
catgagatttatcgtggtgaagaatcgcaaacagattatcaaaagcgtattgccgatagt
ttggccatattgaatggagtaggtgactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system