KEGG   Staphylococcus epidermidis ATCC 12228: SE2193Help
Entry
SE2193            CDS       T00110                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K19083  
bacitracin transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Two-component system
Module
Bacitracin transport system
Bacitracin resistance, VraDE transporter
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2193
  Signal transduction
   02020 Two-component system
    SE2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2244775..2245524)
Genome map
AA seq 249 aa AA seqDB search
MLLEVKNVKKVYGRGMNTTMALNQMNLEIDENEFVAIMGESGSGKSTLLNLIATFDRTTE
GLIKLDGLPLNQLKNKDIARFRREMMGFVFQDFNVLNTMSNKDNILMPLVLANERPKIMQ
KRLMEISEQLGIEDLLEKYPSEISGGQKQRIAIARALIARPKLLLADEPTGALDSKTSKN
LMCLFRKINQKHQTILMVTHSNIDASYANRVIFIKDGRLYHEIYRGEESQTDYQKRIADS
LAILNGVGD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgttattagaggttaaaaatgtaaaaaaagtctatggcagaggtatgaacacgacaatg
gctttaaatcaaatgaaccttgaaattgatgaaaatgaatttgtagcaatcatgggcgag
tcaggttcaggtaaatctacattactcaatttaattgctacttttgatcgtacaactgaa
ggattaataaagttagacgggttgccgcttaatcaattgaagaataaagacattgcacgc
tttcgcagagaaatgatgggatttgtgtttcaagattttaatgtgttgaatacgatgtcg
aacaaagataatattttgatgcctcttgtacttgcaaatgaacgtccgaaaataatgcaa
aaacgcttaatggaaataagtgaacaattaggaattgaagacttgcttgaaaaatatccg
tctgaaatatctgggggacaaaaacaacggatagctatagcccgtgcgttgatagcacga
cctaaattattattagctgatgaacccactggtgcacttgattcaaaaacctctaaaaac
cttatgtgtttatttcgaaaaattaatcaaaagcatcaaactatattaatggtgacacat
tcaaatattgacgcgtcatatgcgaaccgtgtcatcttcatcaaagatggtcgtttgtat
catgagatttatcgtggtgaagaatcgcaaacagattatcaaaagcgtattgccgatagt
ttggccatattgaatggagtaggtgactaa

DBGET integrated database retrieval system