KEGG   Staphylococcus epidermidis ATCC 12228: SE2194Help
Entry
SE2194            CDS       T00110                                 

Definition
two-component sensor histidine kinase
Orthology
K00936  
[EC:2.7.3.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2245635..2246531)
Genome map
AA seq 298 aa AA seqDB search
MKFAYIQSIRNEISIILIILLFFALIFYVFSLPFDAYVLAISIILLLMCVRWWIKYLSFK
KNEHLKDKVAYLEHELAHVKNQQIEYRNDVESYFLTWVHQIKTPITASQLLLERNEENVV
NRVRQEIVHIDNYTSLALSYLKLLNEESDMTITKVTVDDLIRPLILKYRIQFIEQKTQIH
YEKSEDIILTDAQWASIMIEQLLNNALKYAKGKDIWIDFDVANQTLQIKDNGIGISKADI
PKIFDKGYSGFNGRLNEQSTGIGLFIVQHIANHLNIQVTVQSELNHGTVFFIHFTKEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgcatatattcaatcgattcgtaatgagatttcaattattttaataattcta
ttattttttgcacttatattttatgtgttttctttaccttttgatgcatacgtactagca
atcagtataatattactattgatgtgtgtacgttggtggataaagtatttaagttttaaa
aagaatgaacatcttaaagataaagtagcatatttagaacatgagttagcacatgttaag
aatcagcaaattgaatatcgtaacgatgttgaaagttattttttaacatgggtacatcaa
attaaaacacctatcactgcctcacaattacttttggagagaaacgaggagaatgtagtt
aatcgtgttcgacaagaaattgtgcacattgataattatacaagtctcgcattaagttat
ttaaaattattaaatgaagagtcagatatgacaattaccaaagtgacagttgatgatttg
attcgcccgttgattttaaaatatagaattcagtttattgaacaaaagacgcaaatccat
tatgaaaaaagtgaggacattattttaaccgatgcacaatgggcttctataatgatagag
caacttttaaataatgctttaaaatatgctaaaggtaaagatatttggatagattttgat
gttgccaatcaaactctacagattaaagataatggtattgggattagtaaagcagatatt
cctaaaatttttgataaaggatactcaggatttaacggtagattgaatgaacaatcaact
ggtataggtctatttatagtgcaacacattgcaaatcatttaaatatacaagtaactgta
caatcagagttgaatcatgggacagtattttttatacattttactaaagaaaaataa

DBGET integrated database retrieval system