KEGG   Staphylococcus epidermidis ATCC 12228: SE2198Help
Entry
SE2198            CDS       T00110                                 

Definition
hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2249301..2250845)
Genome map
AA seq 514 aa AA seqDB search
MSKILLTGASGYIGSHLKNKLKKDHEVIAISRNTHNKTDEENVTWKSADLFDLDEITKVM
KDVDTAIYLVHSMMPSAKLTQASFEDMDALLADNFARAAQKQGVKHIVYMSGLIPENDEL
SAHLRSRLECEKILGDYGIPVSTLRAGLIIGAKGSSYPILKRLVKRLPAMVLPSWAYNKI
APVAIDDVIDGLAALVNRTPKDNEAIDITGPEVMNYKTLIQRTANVLDKRLPMLDLPIIP
IIVSRYWVQLISNVPKEMVYPLMNSLTHDMVPHRKRVVSNLSVGNITFEDSVKRALREEQ
KTSKKKSDSKNSQSFGRMHQEIKDVRAITRFKIPEGYSIKDVTKEYAKFINNITLHLVKG
TINEREFNMNLPFINKFILKMERDEADSTEDMVVYNIVGGDLAHSNDGGNARFEFRRIRN
TNEGIIALQEYEPTLPWVVYKLTQAKAHKTVMNIFKNKMARLAQQKNVKDETYMSNRVTI
GVTVASAFVIGSAVGFQLFKKHQIKKNTMSNAEL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattttactaactggtgcatcaggttatattggtagccatctcaagaataaa
ttaaaaaaagatcatgaagtgatagctatatccagaaatactcataataaaacggatgaa
gaaaatgtcacgtggaagtcagcagacttatttgatttggacgaaattacaaaagtaatg
aaagatgtagatacagcgatatatttagtacactctatgatgccatcagcaaaattaacg
caggctagctttgaagatatggatgcattgttagcagataattttgcgcgtgcggcgcaa
aagcagggtgttaagcatattgtctacatgagtggtttaataccagaaaatgatgagcta
tctgcacatttaagaagtcgacttgaatgtgaaaaaattcttggtgattacggtatacca
gttagcacattacgtgcaggtttaattattggtgcaaaaggaagttcttatccaattctt
aaacgactagttaagagattgccagcaatggttttgcctagttgggcttacaataaaatt
gcacctgttgccattgacgatgtgatagatggtttagcagcattggtgaatcgaacaccc
aaagataacgaagcaattgatatcacaggtcctgaagtgatgaattataaaacgctgata
cagcgcacagctaacgtacttgataagcgactgcctatgcttgatttacctattataccc
attatcgtaagtcggtattgggtacaactgatttcaaatgtaccgaaagaaatggtatat
ccattaatgaatagtttaactcacgatatggtaccacatcgaaaacgcgttgtgtctaac
ttgtccgtaggaaatatcacctttgaagatagtgtgaaaagagcactaagagaagaacaa
aagacttctaagaaaaagtcggattcgaaaaattctcaatcatttgggcgtatgcatcaa
gaaattaaagatgtacgagccattacacggtttaaaattccggaaggttattcgattaaa
gatgtgactaaagaatatgcaaaattcatcaataatatcacactacatctcgttaaaggt
acgataaatgaacgagaatttaatatgaatttgcccttcattaataaatttattttaaaa
atggaacgtgatgaagctgactctacagaagatatggtggtatataatattgtgggtggc
gatttagcacattcaaatgatggtggaaatgcacgctttgaattccgaagaataagaaac
accaatgagggtattattgctttacaagaatatgaacctacattaccttgggtagtatat
aaactaactcaagctaaagcacacaagactgttatgaatatttttaaaaataaaatggca
cgtttagcgcaacaaaaaaatgtgaaagatgaaacatatatgtctaatcgtgtaactatt
ggagtaacagtagcatcagcgttcgttattggaagcgcagtagggttccaactttttaaa
aagcatcaaatcaaaaagaacacaatgtcgaatgcagaattataa

DBGET integrated database retrieval system