KEGG   Staphylococcus epidermidis ATCC 12228: SE2228Help
Entry
SE2228            CDS       T00110                                 

Definition
(RefSeq) PTS system fructose-specific transporter subunit II
  KO
K02768  PTS system, fructose-specific IIA component [EC:2.7.1.202]
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  PTS system, fructose-specific IIC component
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00051  Fructose and mannose metabolism
sep01100  Metabolic pathways
sep01120  Microbial metabolism in diverse environments
sep02060  Phosphotransferase system (PTS)
Module
sep_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SE2228
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SE2228
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     SE2228
Transporters [BR:sep02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    SE2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS_EIIC PTS_IIB
Motif
Other DBs
NCBI-GeneID: 1056513
NCBI-ProteinID: NP_765783
UniProt: A0A0H2VIJ3
Position
2282923..2284863
Genome map
AA seq 646 aa AA seqDB search
MKILAITSCPNGIAHTYMAQEKLEQAAKDMGVDIKVETQGGVGAENVLTSKEIKEADGII
IAADRQVDLSRFNGKPLINESVREGIHRPKELIQRVIDQDAQIYHDQNISSNMSRDQEES
HKSNIQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGHTTPKGLVIPEDSFWKSIENIG
SLSFKFMVPILAGYIAVSIADKPGLVPGMIGGAIAADGSLYGSEAGAGFLGGIVAGFLAG
YIAKWIKQIKVPKAMAPIMPIIIIPILSSLIVGLIFIFVIGAPISNIFGALTSWLKGMQG
ANIIILALIIGAMIAFDMGGPVNKVAFLFGSALIAEGNYTVMGMVAVAVCTPPIGLGLAT
FVRKHQFNKAEQEMGKASFTMGLFGITEGAIPFAAQDPLRIIPANMIGAMIASVIAAVGG
VGDKVAHGGPIVAVLGGISNILWFFIAVVVGSLVTMFTVLLFKRHTPAIAKSNNGNDTSV
GTENVFSDDQSINHSKQLSHHMVFDKSLIEITKEPMTRDQAIDRLLTKLCHRHYITNIEE
VRTAILKREAESTTAIGMNVAIPHAKSHAVKRPIVAVLNHKAGVEWESLDESNPQLIFLI
AVPNDNNDTHLKLLQRLSRTLMKDNTRDELIHAQSRDEIFNILKEI
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacttgcaattacatcatgtccaaatggaattgctcatacatatatggctcaa
gaaaaattagaacaagcagcaaaagatatgggcgttgatattaaggttgaaactcaagga
ggcgtcggagcagaaaacgtgctcacttctaaagaaatcaaagaagctgatggaatcatc
attgctgccgatagacaggtagatttatcaaggtttaatggtaaacctctcatcaatgaa
agtgtacgtgaaggtattcatagacccaaggaattaatacaacgtgtgattgaccaagat
gcacaaatttaccatgatcaaaatatttcttcaaatatgtctagagaccaggaagaatct
cataaaagtaatattcaaatggtatatcagcatttaatgaatggtgtttccttcatggtt
ccatttatcgtcgttggcggtttactcatagctattgccttaactcttggaggacacacc
actccaaaaggattagttatccccgaagattcattttggaaatctattgaaaatattggt
agtttatcgtttaaattcatggttcccatccttgctggttatatcgcggtgagtattgct
gataagcctggtcttgttccaggtatgattggtggtgccattgctgctgatggtagttta
tatggaagtgaagcaggagccggtttccttggtggtatcgtcgcaggtttcttagcgggc
tatattgcaaaatggattaaacagattaaagttcctaaagctatggctcctattatgcct
attattattatacctattctatcttctttaatagttggtctcatttttatatttgtaata
ggcgcaccaatttcaaatatatttggtgcattaacatcatggttaaaaggaatgcaaggt
gctaacatcattattcttgctcttattattggcgcgatgattgcttttgatatgggaggt
ccagtaaacaaagtagcattcttattcggttctgcattaattgctgaaggcaactacact
gtgatgggaatggttgctgtagcagtatgtacaccaccgattggtttaggtttagctaca
tttgttcgtaaacaccaattcaataaagcagaacaagaaatgggtaaggcatcatttacg
atgggattatttggtattactgaaggggcaatcccttttgctgcacaagatcctctaaga
atcattccagccaatatgattggcgcgatgattgcttcagtaatagcggcggttggaggt
gtcggtgataaagttgctcatggaggtcctattgtcgctgtactaggtggaataagtaat
attttatggttctttatagctgttgtcgttggaagcttagtaaccatgttcacagtcttg
ttatttaagcgtcacacccctgctatagcaaaaagcaataatggaaatgatacttctgtt
ggaactgaaaatgtattttctgatgaccaatctattaatcacagcaaacaactctcacat
catatggtgttcgataaatcactcattgaaattaccaaggaaccaatgacaagagatcaa
gctattgatagattacttactaagttatgccatcgtcattacattacgaatatagaagag
gtaagaaccgcaatccttaaacgagaggctgagtcaacaactgctatcggaatgaacgtt
gcaataccacatgctaaatctcatgcagttaaacgtcctatcgtcgctgtattaaatcat
aaagcaggtgtagagtgggaaagtctagatgaatcaaatcctcagctcatttttcttatt
gcagttcccaatgataataacgatacacatttaaaactgctacaacggttatcacgaacg
ctcatgaaagataatacgcgtgatgagttaattcatgctcaaagtcgtgatgaaatattt
aatattttaaaagagatataa

DBGET integrated database retrieval system