KEGG   Staphylococcus epidermidis ATCC 12228: SE2228Help
Entry
SE2228            CDS       T00110                                 

Definition
PTS system fructose-specific transporter subunit II
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SE2228
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SE2228
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     SE2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2282923..2284863
Genome map
AA seq 646 aa AA seqDB search
MKILAITSCPNGIAHTYMAQEKLEQAAKDMGVDIKVETQGGVGAENVLTSKEIKEADGII
IAADRQVDLSRFNGKPLINESVREGIHRPKELIQRVIDQDAQIYHDQNISSNMSRDQEES
HKSNIQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGHTTPKGLVIPEDSFWKSIENIG
SLSFKFMVPILAGYIAVSIADKPGLVPGMIGGAIAADGSLYGSEAGAGFLGGIVAGFLAG
YIAKWIKQIKVPKAMAPIMPIIIIPILSSLIVGLIFIFVIGAPISNIFGALTSWLKGMQG
ANIIILALIIGAMIAFDMGGPVNKVAFLFGSALIAEGNYTVMGMVAVAVCTPPIGLGLAT
FVRKHQFNKAEQEMGKASFTMGLFGITEGAIPFAAQDPLRIIPANMIGAMIASVIAAVGG
VGDKVAHGGPIVAVLGGISNILWFFIAVVVGSLVTMFTVLLFKRHTPAIAKSNNGNDTSV
GTENVFSDDQSINHSKQLSHHMVFDKSLIEITKEPMTRDQAIDRLLTKLCHRHYITNIEE
VRTAILKREAESTTAIGMNVAIPHAKSHAVKRPIVAVLNHKAGVEWESLDESNPQLIFLI
AVPNDNNDTHLKLLQRLSRTLMKDNTRDELIHAQSRDEIFNILKEI
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacttgcaattacatcatgtccaaatggaattgctcatacatatatggctcaa
gaaaaattagaacaagcagcaaaagatatgggcgttgatattaaggttgaaactcaagga
ggcgtcggagcagaaaacgtgctcacttctaaagaaatcaaagaagctgatggaatcatc
attgctgccgatagacaggtagatttatcaaggtttaatggtaaacctctcatcaatgaa
agtgtacgtgaaggtattcatagacccaaggaattaatacaacgtgtgattgaccaagat
gcacaaatttaccatgatcaaaatatttcttcaaatatgtctagagaccaggaagaatct
cataaaagtaatattcaaatggtatatcagcatttaatgaatggtgtttccttcatggtt
ccatttatcgtcgttggcggtttactcatagctattgccttaactcttggaggacacacc
actccaaaaggattagttatccccgaagattcattttggaaatctattgaaaatattggt
agtttatcgtttaaattcatggttcccatccttgctggttatatcgcggtgagtattgct
gataagcctggtcttgttccaggtatgattggtggtgccattgctgctgatggtagttta
tatggaagtgaagcaggagccggtttccttggtggtatcgtcgcaggtttcttagcgggc
tatattgcaaaatggattaaacagattaaagttcctaaagctatggctcctattatgcct
attattattatacctattctatcttctttaatagttggtctcatttttatatttgtaata
ggcgcaccaatttcaaatatatttggtgcattaacatcatggttaaaaggaatgcaaggt
gctaacatcattattcttgctcttattattggcgcgatgattgcttttgatatgggaggt
ccagtaaacaaagtagcattcttattcggttctgcattaattgctgaaggcaactacact
gtgatgggaatggttgctgtagcagtatgtacaccaccgattggtttaggtttagctaca
tttgttcgtaaacaccaattcaataaagcagaacaagaaatgggtaaggcatcatttacg
atgggattatttggtattactgaaggggcaatcccttttgctgcacaagatcctctaaga
atcattccagccaatatgattggcgcgatgattgcttcagtaatagcggcggttggaggt
gtcggtgataaagttgctcatggaggtcctattgtcgctgtactaggtggaataagtaat
attttatggttctttatagctgttgtcgttggaagcttagtaaccatgttcacagtcttg
ttatttaagcgtcacacccctgctatagcaaaaagcaataatggaaatgatacttctgtt
ggaactgaaaatgtattttctgatgaccaatctattaatcacagcaaacaactctcacat
catatggtgttcgataaatcactcattgaaattaccaaggaaccaatgacaagagatcaa
gctattgatagattacttactaagttatgccatcgtcattacattacgaatatagaagag
gtaagaaccgcaatccttaaacgagaggctgagtcaacaactgctatcggaatgaacgtt
gcaataccacatgctaaatctcatgcagttaaacgtcctatcgtcgctgtattaaatcat
aaagcaggtgtagagtgggaaagtctagatgaatcaaatcctcagctcatttttcttatt
gcagttcccaatgataataacgatacacatttaaaactgctacaacggttatcacgaacg
ctcatgaaagataatacgcgtgatgagttaattcatgctcaaagtcgtgatgaaatattt
aatattttaaaagagatataa

DBGET integrated database retrieval system