KEGG   Staphylococcus epidermidis ATCC 12228: SE2228Help
Entry
SE2228            CDS       T00110                                 

Definition
PTS system fructose-specific transporter subunit II
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sep00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:sep02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2282923..2284863
Genome map
AA seq 646 aa AA seqDB search
MKILAITSCPNGIAHTYMAQEKLEQAAKDMGVDIKVETQGGVGAENVLTSKEIKEADGII
IAADRQVDLSRFNGKPLINESVREGIHRPKELIQRVIDQDAQIYHDQNISSNMSRDQEES
HKSNIQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGHTTPKGLVIPEDSFWKSIENIG
SLSFKFMVPILAGYIAVSIADKPGLVPGMIGGAIAADGSLYGSEAGAGFLGGIVAGFLAG
YIAKWIKQIKVPKAMAPIMPIIIIPILSSLIVGLIFIFVIGAPISNIFGALTSWLKGMQG
ANIIILALIIGAMIAFDMGGPVNKVAFLFGSALIAEGNYTVMGMVAVAVCTPPIGLGLAT
FVRKHQFNKAEQEMGKASFTMGLFGITEGAIPFAAQDPLRIIPANMIGAMIASVIAAVGG
VGDKVAHGGPIVAVLGGISNILWFFIAVVVGSLVTMFTVLLFKRHTPAIAKSNNGNDTSV
GTENVFSDDQSINHSKQLSHHMVFDKSLIEITKEPMTRDQAIDRLLTKLCHRHYITNIEE
VRTAILKREAESTTAIGMNVAIPHAKSHAVKRPIVAVLNHKAGVEWESLDESNPQLIFLI
AVPNDNNDTHLKLLQRLSRTLMKDNTRDELIHAQSRDEIFNILKEI
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacttgcaattacatcatgtccaaatggaattgctcatacatatatggctcaa
gaaaaattagaacaagcagcaaaagatatgggcgttgatattaaggttgaaactcaagga
ggcgtcggagcagaaaacgtgctcacttctaaagaaatcaaagaagctgatggaatcatc
attgctgccgatagacaggtagatttatcaaggtttaatggtaaacctctcatcaatgaa
agtgtacgtgaaggtattcatagacccaaggaattaatacaacgtgtgattgaccaagat
gcacaaatttaccatgatcaaaatatttcttcaaatatgtctagagaccaggaagaatct
cataaaagtaatattcaaatggtatatcagcatttaatgaatggtgtttccttcatggtt
ccatttatcgtcgttggcggtttactcatagctattgccttaactcttggaggacacacc
actccaaaaggattagttatccccgaagattcattttggaaatctattgaaaatattggt
agtttatcgtttaaattcatggttcccatccttgctggttatatcgcggtgagtattgct
gataagcctggtcttgttccaggtatgattggtggtgccattgctgctgatggtagttta
tatggaagtgaagcaggagccggtttccttggtggtatcgtcgcaggtttcttagcgggc
tatattgcaaaatggattaaacagattaaagttcctaaagctatggctcctattatgcct
attattattatacctattctatcttctttaatagttggtctcatttttatatttgtaata
ggcgcaccaatttcaaatatatttggtgcattaacatcatggttaaaaggaatgcaaggt
gctaacatcattattcttgctcttattattggcgcgatgattgcttttgatatgggaggt
ccagtaaacaaagtagcattcttattcggttctgcattaattgctgaaggcaactacact
gtgatgggaatggttgctgtagcagtatgtacaccaccgattggtttaggtttagctaca
tttgttcgtaaacaccaattcaataaagcagaacaagaaatgggtaaggcatcatttacg
atgggattatttggtattactgaaggggcaatcccttttgctgcacaagatcctctaaga
atcattccagccaatatgattggcgcgatgattgcttcagtaatagcggcggttggaggt
gtcggtgataaagttgctcatggaggtcctattgtcgctgtactaggtggaataagtaat
attttatggttctttatagctgttgtcgttggaagcttagtaaccatgttcacagtcttg
ttatttaagcgtcacacccctgctatagcaaaaagcaataatggaaatgatacttctgtt
ggaactgaaaatgtattttctgatgaccaatctattaatcacagcaaacaactctcacat
catatggtgttcgataaatcactcattgaaattaccaaggaaccaatgacaagagatcaa
gctattgatagattacttactaagttatgccatcgtcattacattacgaatatagaagag
gtaagaaccgcaatccttaaacgagaggctgagtcaacaactgctatcggaatgaacgtt
gcaataccacatgctaaatctcatgcagttaaacgtcctatcgtcgctgtattaaatcat
aaagcaggtgtagagtgggaaagtctagatgaatcaaatcctcagctcatttttcttatt
gcagttcccaatgataataacgatacacatttaaaactgctacaacggttatcacgaacg
ctcatgaaagataatacgcgtgatgagttaattcatgctcaaagtcgtgatgaaatattt
aatattttaaaagagatataa

DBGET integrated database retrieval system