KEGG   Staphylococcus epidermidis ATCC 12228: SE2233Help
Entry
SE2233            CDS       T00110                                 

Definition
general stress protein 170
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2293901..2294329
Genome map
AA seq 142 aa AA seqDB search
MANSIYSTTMISNGGRDGRVFSPDNTFVQNLATPKEMGGQGGNDTNPEQLFAAGYSACFN
SALSLILSQNKISDANPEVEITIELLKDDTDNGFKLGADIKVTLENMSQQDAEKFVEQAH
QFCPYSKATRGNIDVQLDVTAQ
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattctatttactcaactacaatgatttcaaatggtggacgtgatggtcgcgtt
tttagtccagataatacatttgttcaaaaccttgcaacacctaaggaaatgggtggtcaa
ggaggcaacgatactaatcctgaacaattatttgctgctggatatagtgcatgctttaat
agcgcgctatcattaatcttatctcaaaataaaataagtgatgccaacccagaagttgaa
atcactattgaattacttaaagatgatactgacaatggttttaaacttggcgcagatatt
aaagtcacacttgaaaatatgtcccaacaagatgctgagaaatttgtggagcaagcacat
caattctgtccatactcaaaagcgacacgtggtaacattgacgttcagttagatgttaca
gcgcaataa

DBGET integrated database retrieval system