KEGG   Staphylococcus epidermidis ATCC 12228: SE2243Help
Entry
SE2243            CDS       T00110                                 

Definition
lipopolysaccharide biosynthesis protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2300870..2302378)
Genome map
AA seq 502 aa AA seqDB search
MTIYNINFGIGWASSGVEYAQVYRAKLLRQLPYPTKFIFLDFIQSENIQTLTSNIGFKDD
EVIWLYQYFTDVKIAPTTYTVDDLISELGNEVTRKEQNGKVLRLYLNNQQTFVTCYLKNA
NEHYVDRAEFVVNGMLIRKDFYSYVRTFSEYYAPFNNKAKIYMRQFYNENGSIAYREYID
EDEHVFVFDDARLYSKQALVAYFIRQLLLNSEDIIIIDRATDVGQAILENKGSSKVGVVV
HAEHFSEGATDGTHILWNNYYEYQFENAQHIDFFITATDLQRQTLSEQFKQYKNDCPRIR
TIPVGSIESLQYPEKERKPYSIMTASRLANEKHVDWIVEAVIKAKHQLPQLSFDIYGQGE
EQEKIKNIITKHRAEDYIQIKGHRNLRTIYQQYELFIAASQSEGFGLTLMEAVGSGLGMI
GFDVNYGSPTFIRHHQNGYLIPIDFEQASTDDITTQIAHMIIRYFEDGPIRAHEVSYDIA
ESFKTSHIVDLWRQLIEEVLYD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttataatatcaattttggaatcggttgggccagtagtggtgttgaatatgca
caagtgtatcgagcaaaactattaaggcaattaccttatccaacaaaatttatattttta
gattttattcaatcagaaaatattcaaacactcacaagcaacatagggtttaaagatgat
gaagttatttggctatatcaatacttcacagacgtaaaaatcgctcctacaacgtacaca
gttgatgatttaatttcagagttaggtaatgaggttactcgaaaagaacaaaacggtaaa
gtattacgactctatttaaataatcagcaaacattcgtaacctgctatttaaaaaatgct
aacgaacattacgttgatcgtgcagagtttgtggtgaatggaatgttaattaggaaagat
ttttatagctatgtaagaacattctcggagtattatgctccttttaacaataaagctaaa
atatatatgcgtcaattttataatgaaaatggatcaattgcatatcgcgaatatatagat
gaagatgaacatgtttttgtgtttgatgatgcacgtttatacagtaaacaagcactcgtc
gcatactttatacgtcaattgctattgaattcagaggatatcattattattgatcgagca
actgatgtgggacaagccatattagaaaacaagggatccagtaaagttggcgtagtcgtt
cacgctgaacatttcagtgaaggtgcgactgatgggactcacattttatggaataattat
tatgagtatcaattcgaaaatgcacagcatattgatttctttatcacagcgacagatttg
caaaggcagacactaagtgaacaatttaaacaatataagaatgattgtccacgtatacgt
acaattccagtaggtagtatagaatcgttacaatatcctgaaaaagaaagaaaaccatat
tccatcatgaccgcatcacgtcttgctaacgaaaaacatgttgattggatagtggaagct
gtgattaaagctaaacatcagttacctcaattgagttttgatatctacggacaaggagaa
gaacaagaaaaaattaaaaatattattaccaaacatcgtgctgaggattacatacaaatt
aaaggacatagaaatcttcgtacaatatatcagcaatatgaattattcatagcggcctca
caaagtgaagggttcggactgacattaatggaagcggttggctctggtttaggtatgatt
ggatttgatgtgaattatggcagtccgacatttattcgacatcatcaaaatggctatttg
ataccgatagattttgaacaagcgtctactgatgatatcacaacgcaaatcgctcatatg
attattcgatattttgaagatggtcccataagggcacatgaggtatcgtatgacattgca
gaatcatttaaaacatcgcatattgttgatctatggagacaactcattgaagaggtgcta
tatgattaa

DBGET integrated database retrieval system