KEGG   Staphylococcus epidermidis ATCC 12228: SE2255Help
Entry
SE2255            CDS       T00110                                 

Definition
transport system protein
Orthology
K02041  
phosphonate transport system ATP-binding protein [EC:3.6.3.28]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Phosphonate transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2255
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.28  phosphonate-transporting ATPase
     SE2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2320349..2321122)
Genome map
AA seq 257 aa AA seqDB search
MSQIEFKDVSKVYPNGHVGLKDINLNIEKGDFAVIVGLSGAGKSTLLRSVNRLHDISKGD
ITIEGQSITKARGKKLLEMRRSIGMIFQHFNLVKRSTVLRNVLSGRVGYHPTWKMILGLF
PKEDKVKALDALERVNILDKYDQRSDQLSGGQQQRISIARALCQEPTIILADEPVASLDP
LTTKQVMDDLKKINEELGITILINLHFVDLAKEYGSRIIGLRAGELVYDGPASEANDEVF
NHIYGRSIKDDEKLGVE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatcgaatttaaggatgttagtaaagtgtatccaaatgggcatgtgggatta
aaagatattaacttaaatatagaaaaaggtgattttgcagttattgttggattgtctgga
gcaggtaaatcaacattactacgatcggttaatcggctacatgatatttccaaaggtgat
attactatcgaaggtcagtcaataactaaagcacgtggtaaaaaattattagaaatgcgt
cgaagtataggtatgatttttcaacattttaacttagttaagcgttcaacagtgcttaga
aatgttttgagtggcagggtaggataccatcctacttggaaaatgatacttggtcttttt
cctaaagaagataaagtcaaggcattggatgccttagaacgtgtaaatattttagataaa
tatgaccaacgctctgaccagttgtcaggtggtcaacaacaacgtatatcaatagctaga
gcgttatgtcaggaaccaaccattatattagcagacgaaccagttgcttcattagatcca
ttaactacaaaacaagtgatggatgacttaaagaaaatcaatgaagaacttggtattact
attttaattaatttacactttgttgatttggcaaaggaatacggatcgagaataattggt
ttaagagcgggagagctcgtttatgatggacccgcgtctgaggcaaatgacgaagtattt
aatcatatatacggtcgctctattaaggacgatgaaaaattaggggtggaataa

DBGET integrated database retrieval system