KEGG   Staphylococcus epidermidis ATCC 12228: SE2258Help
Entry
SE2258            CDS       T00110                                 

Definition
lactococcal phosphatase-like protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2324074..2325609
Genome map
AA seq 511 aa AA seqDB search
MSQIAFYILSDVHGFIFPTDFSSREKDLPMGLLKANHLIEQDCVHYDGSVKIDNGDFLQG
SPLCNYLVSKLKSSLPLTSIYNRLGFDFGIVGNHEFNYDLPYLKQAINQLHYPVLCANII
ENTQPFTGQGIHYFKVNDLTIGTIGLTTQYIPHWEQPDYIKTLTFNSAVHILKSELPTLR
EKSDIVVVSYHGGFERDLDSGLPTEALTGENEGYDILSQFSDSIDVLITGHQHRDIATIK
NQTAIIQPGSKGTKVGKIVIEYTHDKKVLIKECNLMNVNNNTSFKPNVEDIALRNQLEDW
LDTQIAELPYAMRINNSFEARKSPHAFVNLLNYILLEKSGADIACTALFDSANGFDEKIT
MRDIINNYPFPNTFKVIELSGKDIKLAIERSASYFDIVNHKITVNKEFLEPKPQHFNYDI
FAGIQYTIHVSHPYGERVSDLLINDAPIQSDQIYTICVNNYRAVGGGNYDMYVNKPVIKD
IQIEGAQLLIDYLSHNDLSQIPQVIDFNVVK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaattgcgttctatatccttagtgatgttcacggttttatattcccaacagat
ttttcatcaagagaaaaagatttacctatgggtttgttaaaagctaatcatctaatcgaa
caagactgcgtgcactatgacggcagtgtaaagatcgataatggggacttcttacaaggt
tctccattatgtaactacttagtatctaaattaaagagtagtctcccattaacatcaata
tataatcgtttagggtttgattttggaattgttggcaatcatgaatttaattatgattta
ccttatctaaaacaggccatcaatcaacttcattacccagttttgtgtgcaaatataatt
gaaaatacacagccattcactggccaaggtattcattattttaaagtaaatgatttaact
ataggaactattggattaaccactcagtatattcctcactgggaacaacctgattacatt
aagacactcacttttaacagtgctgtccacatattaaaatctgagttacctacacttagg
gaaaagagtgatattgtagtagtaagttatcatggtggttttgaacgtgatttagatagt
ggcctcccgactgaggcgcttactggggaaaacgaagggtatgatatactaagtcagttt
agcgatagtatcgatgtgttgataaccggccatcaacatcgtgatattgcgacaatcaag
aaccaaacagccatcattcaaccaggttcaaaaggtacaaaagttggaaaaatagttatt
gaatatacacatgataaaaaagtattaattaaagaatgtaacttaatgaatgttaataac
aatacctcctttaagccgaatgtcgaagatatcgctttacgtaatcaattggaagattgg
cttgatactcaaatcgcagaactcccctacgctatgagaataaacaattcatttgaggca
agaaaatcaccgcatgcatttgttaaccttcttaattatattttattagaaaaaagtggt
gcagatattgcatgtacagcactatttgattccgcaaatggctttgatgagaaaataacc
atgcgtgatatcatcaataattatccttttcctaatacttttaaagtgattgaacttagt
ggaaaagatattaaacttgcaattgaacgaagcgcaagttattttgacattgttaatcat
aaaatcacagttaataaagagtttctagaacctaaacctcagcatttcaactatgacata
tttgcaggtatccaatatacaattcatgttagtcatccttacggtgaacgtgttagtgat
ttactaattaatgatgcaccaatacaaagtgatcaaatatatacaatatgcgtaaataat
tatagagctgttggtggcgggaattatgatatgtacgttaacaaacctgtgataaaagat
attcaaatcgaaggtgctcaattgttaatagattacttatctcacaatgatttatcacaa
atcccacaagtgattgatttcaatgttgttaagtaa

DBGET integrated database retrieval system