KEGG   Staphylococcus epidermidis ATCC 12228: SE2318Help
Entry
SE2318            CDS       T00110                                 

Definition
poly (glycerol-phosphate) alpha-glucosyltransferase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2400356..2401861
Genome map
AA seq 501 aa AA seqDB search
MIYTVTTTLPLSHGGRTQALLRRIKLLDEEFKIPSKILTTNYHGNYPSIYKKYRQENKVT
ENIQFENMYEWLSNFKLFKVPKTLITRNPKYIKTPRKIKGLIDKQGKKSGLIHYYNNECH
VRSRKYYGQSNVLEYEDFISPTSGLKYERHQYNLYGQLHRKEYYYDDSSLKHSDELFDTE
GSMYCKRYFKTKPNSKINGVEIYRNKKLYKTFKNDKLLAQFYFQNRFKNQDIVFNDARFL
DKPLLKQTHQTKNILVLHSSHLSGDQIKKSYRFALNQSKNVYKYIVLTHQQKHDIQQHFH
ISDDQFQLVPHFIELDTEVEQDSSNNQNRFIYIGRFSTEKQIDHIIRAYHKFLQSGYQTE
LHLFGRDEDNQIPLMNTLISELKLSDKVKIFKYTNQPLQEFKNSKASLLTSQYEGFGLTL
MESIEMGCPVLSYNVRYGPSEIIQNGINGYLIEKNDIDSLSKHMINIIEHPLQKVKNKDT
LKYNAAVNNYKQLMQSLDLLK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgatatacacagtaacaaccacccttccattatcccatggtggtagaactcaagcttta
ctcagacgaattaaactgttagatgaagaatttaaaattccaagtaaaattctcaccact
aattatcatggtaattatcctagtatttataaaaaatacagacaagaaaacaaagttaca
gaaaatatacaattcgagaatatgtatgaatggttatcaaatttcaaactttttaaagtc
ccaaaaacattgattactaggaatccaaaatacattaaaacacctagaaagattaaagga
cttattgataagcaaggaaaaaagagtggtcttattcattattataataatgaatgtcat
gtgagatctcgaaagtattatggacagtctaatgttcttgaatatgaggacttcatttct
cccacatcaggattgaaatatgagcgccatcaatataacttatacggccaacttcataga
aaagaatattattatgatgactcttctttaaaacatagcgacgaattatttgatactgag
ggctctatgtactgcaagagatatttcaaaactaaaccaaacagcaaaattaatggcgta
gaaatatatagaaataaaaaactttataagacctttaaaaatgataaattattagctcag
ttttattttcagaatagattcaaaaatcaagatatcgtctttaatgatgctcgattttta
gataaaccattacttaaacaaacgcaccaaacaaaaaatattcttgttttacatagctcg
catttatcaggggaccaaataaaaaaatcatatcgatttgctttaaatcaatcaaaaaat
gtttataagtatattgttctcactcaccaacaaaagcacgatatacagcaacatttccat
ataagtgacgaccaattccaactagtaccacattttatcgaattagatacggaggtagaa
caagattcctcaaacaatcaaaatcgctttatatatataggccgttttagcacagagaaa
cagattgatcatattattagagcttatcacaagtttttgcaaagtggttaccaaacagaa
ttacatttatttggtagagatgaagataatcaaattccattgatgaatactttgatttca
gaattaaaattatcggataaagttaaaatatttaaatataccaatcaacctttacaagaa
tttaagaattctaaagcctctctacttacaagtcaatatgagggatttggcttaacactt
atggaaagtatagaaatggggtgtccagtcctatcttataacgttcgttacggtccaagt
gaaattattcaaaacgggataaatggctatctcattgaaaaaaatgatattgatagttta
tcaaaacatatgattaacatcattgagcacccactacaaaaagtgaaaaataaagacact
ttaaaatataacgccgcagtgaataattacaaacaacttatgcaaagcttagacttatta
aaatag

DBGET integrated database retrieval system