KEGG   Staphylococcus epidermidis ATCC 12228: SE2319Help
Entry
SE2319            CDS       T00110                                 

Definition
autolysin (N-acetylmuramoyl-L-alanine amidase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2401988..2402962)
Genome map
AA seq 324 aa AA seqDB search
MQKKYITAIIGTTALSALASTHAQAATTHTVKSGESVWSISHKYGISIAKLKSLNGLTSN
LIFPNQVLKVSGSSSRATSTNSGTVYTVKAGDSLSSIAAKYGTTYQKIMQLNGLNNYLIF
PGQKLKVSGKATSSSRAKASGSSGRTATYTVKYGDSLSAIASKYGTTYQKIMQLNGLTNF
FIYPGQKLKVPGGSSSSSSSNNTRSNGGYYSPTFNHQNLYTWGQCTWHVFNRRAEIGKGI
STYWWNANNWDNASAADGYTIDYRPTVGSIAQTDAGYYGHVAFVERVNSDGSILVSEMNW
SAAPGNMTYRTIPAYQVRNYKFIH
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaaaaaatatattactgccattattggaacaactgcccttagcgcattggcatca
actcatgcacaagctgcaacaacgcatacagtaaaaagtggagaatctgtatggtcaatt
tctcacaaatatgggattagtattgctaaattaaaatcacttaatggattgacttccaat
ttaatattccctaatcaagtattgaaagtatcaggctcatcttcaagagcaacgtcaaca
aatagtggcacagtttatacagttaaagctggagattcattatcttctattgctgcaaaa
tacggtacaacttatcaaaaaatcatgcaacttaatgggttaaataactatcttattttc
cctggacaaaagttgaaagtttctggtaaagcgacgagttccagtcgtgcaaaagctagt
gggtctagtggtcgtactgcaacatatactgttaagtatggagactcactatctgcaatt
gctagtaaatatgggacaacgtatcaaaaaattatgcaattaaatggattaactaatttc
tttatctatcctggacagaagttaaaagtgcctggaggtagttctagtagctcatcttct
aataatactagatcaaacggtggctattattcaccaacttttaaccatcaaaacttgtat
acttggggacaatgcacatggcacgtatttaatagacgtgctgaaataggaaaaggtatc
agtacatactggtggaatgcaaataattgggacaatgcatcagctgctgatggatatact
attgattatcgtcctacagtaggctcaattgcacaaactgacgctggttactatggtcac
gtagcgtttgtagagcgcgtgaatagcgatggaagtattttagtttcagaaatgaactgg
agtgcagctcctggaaatatgacatatagaacaattccagcttatcaagtgagaaattac
aaatttattcattaa

DBGET integrated database retrieval system