KEGG   Staphylococcus epidermidis ATCC 12228: SE2320Help
Entry
SE2320            CDS       T00110                                 

Definition
lactococcal lipoprotein
Orthology
K02073  
D-methionine transport system substrate-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
D-Methionine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2403487..2404332)
Genome map
AA seq 281 aa AA seqDB search
MKKILSFLIVAILVLSACGGNNGKKVTIGVASNDTKAWEKVKELAKKDDIDLEIKHFSDY
NVPNKALSDGDIDLNAFQHFAFLDQYKKAHKDTNIEALSTTVLAPLGIYSDKVKNIKDVK
KGAQVAIPNDVSNQARALKLLESAGLIKLKKNFGLNGTTKDIESNPKDLKIKAVDAQQTA
RALSDVDISVINNGVATKAGKDAKKDPIYLEKASSDAVKPYINVVAVNSKDKDNKTYKKI
IELYHSKEAQKALKEDTKDGEKPVDLSKKEIEEIENELAKK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattttaagttttttaatcgttgcaattttagttttatcagcatgtggcggt
aataatggtaaaaaggtaaccataggtgttgcatccaacgacacgaaggcttgggaaaaa
gttaaagaattagctaaaaaagatgatattgatttagaaatcaagcacttttcagattac
aatgttccaaacaaagcacttagtgacggggatattgatttaaatgccttccaacacttt
gcttttttagatcaatataaaaaagctcataaagataccaatattgaagcacttagcact
acagtattagctccattaggtatttattcagataaagttaagaacattaaagatgttaaa
aaaggtgcgcaagttgctattccgaatgatgtatctaaccaagctcgagcacttaagtta
ttagaatctgcaggtttaattaagcttaagaagaactttggattaaacggaacaacaaaa
gatattgaaagtaatcctaaagatttaaaaattaaagctgttgatgcacaacaaacagcg
cgtgcactttctgatgtggatatatcagttatcaataacggtgttgcaacaaaagcagga
aaagacgctaaaaaggatcctatttatttagaaaaagcaagttcagatgcagtaaaacca
tatattaatgttgtagctgtcaactctaaagacaaagataataaaacctacaaaaaaatt
atagaactttatcattcaaaagaagctcaaaaagcattaaaagaagacactaaagacggt
gaaaaaccagtagatctttctaaaaaggaaatcgaagaaatcgaaaatgagttggcaaaa
aaataa

DBGET integrated database retrieval system