KEGG   Staphylococcus epidermidis ATCC 12228: SE2321Help
Entry
SE2321            CDS       T00110                                 

Definition
ABC transporter permease
Orthology
K02072  
D-methionine transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2404376..2405035)
Genome map
AA seq 219 aa AA seqDB search
MFGSSLDSSQLLQALYETLYMVTVSLVIGALIGIPLGILLVVTRKNGIWSNTILHQVLNP
IINILRSIPFIILLIAIVPFTKLLVGTSIGTTAAIVPLTVYVAPYIARLVENSLLEVDDG
IIEAAKAMDASPLQIIRYFLLPEALGSLILAITTAIIGLIGSTAMAGAVGGGGIGDLALV
YGYQRFDTIVIVITVIVLIIIVQIIQTLGNFIARVIRRN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttcaagtttagattcatctcaattattacaagctctatacgaaacattgtat
atggtgactgtatcacttgtaatcggtgctttaataggtatacctcttggcatcttgtta
gtggtaactagaaaaaacggtatatggtcgaatacaatattgcatcaagtattaaatcct
atcattaatattttaagatcaattccgttcattattttattaatagccatagtgcctttt
actaaattgctagttggcacatctatcggcacaacagcagccatagtaccactcacggtt
tatgtagcaccttatatcgcacgcttagtagaaaactcattactggaagtcgatgacggg
attattgaggcagctaaagcaatggatgcatcacctcttcaaattatacgttatttttta
ttgccagaagcacttggttcattaattctagctataactacagctattattggtctcata
ggtagtacagcaatggctggtgctgttggtggtggcggtataggtgatttggctttagtg
tatggttatcaacgattcgatacaattgtcattgtgattacagtcattgtacttattatt
attgttcaaattatacaaacgttaggtaactttatcgctagggttatccgtagaaattaa

DBGET integrated database retrieval system