KEGG   Staphylococcus epidermidis ATCC 12228: SE2322Help
Entry
SE2322            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Orthology
K02071  
D-methionine transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
D-Methionine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2405038..2406063)
Genome map
AA seq 341 aa AA seqDB search
MIEFKNVNKVFRKKRETIQALKNVSFKIDQHDIFGVIGYSGAGKSTLVRLVNQLETVSDG
QVIVDGHEIDTYKEKDLRDIKKDIGMIFQHFNLLNSKSVYKNVAMPLILSKTNKKEIKEK
VDEMLEFVGLADKKDQFPDELSGGQKQRVAIARALVTHPKILLCDEATSALDPATTSSIL
NLLSNVNRTFGVTIMMITHEMSVIQKICHRVAVMENGEVIEMGTVKDVFSHPQTNTAKNF
VSTVINTEPSKELRASFNSRKDSNFTDYKLFLDSEQIQLPILNELINEHHLNVNVLFSSM
SEIQDETVCYLWLRFEHDESFNDFKLTDYLSKRHIRYEEVI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaattcaaaaatgttaacaaagtttttcgcaaaaaaagagaaactattcaagct
ttgaaaaatgtatcatttaagattgaccaacatgatatttttggtgttattggttatagt
ggtgctggtaaaagtacattagttcggttagtcaatcaacttgagacagtatcagatggt
caagttattgttgatggtcatgagattgatacatataaagaaaaagatttacgtgatatt
aaaaaagatatcggtatgatctttcaacatttcaatttgcttaattctaaatcagtctat
aaaaatgttgcaatgccacttattttaagtaagacaaataagaaagaaattaaggaaaaa
gttgacgaaatgttagaatttgtggggcttgctgataaaaaagatcaatttccagatgaa
ttatcaggtggacaaaaacaacgtgttgccatcgcaagagcattagtaacgcatcctaaa
atattattatgtgatgaagcgacaagtgctttggatccagctactacaagctcaatttta
aatttattaagtaatgtgaatcgaacatttggtgtgacgattatgatgattacacatgaa
atgagcgtaattcaaaaaatttgtcatcgtgtagctgtcatggaaaatggcgaagtgata
gaaatggggacagttaaagatgtctttagtcatccacaaacgaacactgcaaaaaatttc
gtttcgacggtgattaacactgagccttcaaaagagttacgggcctcttttaactcgaga
aaagattcaaatttcacagattataaactgtttttagactctgaacaaattcaattgcca
atattgaacgagcttatcaacgagcatcatcttaacgttaacgtattattttcttctatg
tcagaaattcaagatgaaacggtttgttatttgtggttgagatttgagcatgatgagtca
tttaatgattttaaacttactgattacctttcaaaacgacatattcggtatgaggaggtt
atataa

DBGET integrated database retrieval system