KEGG   Staphylococcus epidermidis ATCC 12228: SE2322Help
Entry
SE2322            CDS       T00110                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02010  ABC transporters
Module
sep_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2322
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    SE2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran NIL SMC_N AAA_22 AAA_21 DUF3652 AAA_16 RsgA_GTPase AAA_29 AAA_10 IstB_IS21 OSK AAA_23 AAA_18 AAA_30 AAA_33 MMR_HSR1 SbcCD_C
Motif
Other DBs
NCBI-GeneID: 1057136
NCBI-ProteinID: NP_765877
UniProt: Q8CQS7
Position
complement(2405038..2406063)
Genome map
AA seq 341 aa AA seqDB search
MIEFKNVNKVFRKKRETIQALKNVSFKIDQHDIFGVIGYSGAGKSTLVRLVNQLETVSDG
QVIVDGHEIDTYKEKDLRDIKKDIGMIFQHFNLLNSKSVYKNVAMPLILSKTNKKEIKEK
VDEMLEFVGLADKKDQFPDELSGGQKQRVAIARALVTHPKILLCDEATSALDPATTSSIL
NLLSNVNRTFGVTIMMITHEMSVIQKICHRVAVMENGEVIEMGTVKDVFSHPQTNTAKNF
VSTVINTEPSKELRASFNSRKDSNFTDYKLFLDSEQIQLPILNELINEHHLNVNVLFSSM
SEIQDETVCYLWLRFEHDESFNDFKLTDYLSKRHIRYEEVI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaattcaaaaatgttaacaaagtttttcgcaaaaaaagagaaactattcaagct
ttgaaaaatgtatcatttaagattgaccaacatgatatttttggtgttattggttatagt
ggtgctggtaaaagtacattagttcggttagtcaatcaacttgagacagtatcagatggt
caagttattgttgatggtcatgagattgatacatataaagaaaaagatttacgtgatatt
aaaaaagatatcggtatgatctttcaacatttcaatttgcttaattctaaatcagtctat
aaaaatgttgcaatgccacttattttaagtaagacaaataagaaagaaattaaggaaaaa
gttgacgaaatgttagaatttgtggggcttgctgataaaaaagatcaatttccagatgaa
ttatcaggtggacaaaaacaacgtgttgccatcgcaagagcattagtaacgcatcctaaa
atattattatgtgatgaagcgacaagtgctttggatccagctactacaagctcaatttta
aatttattaagtaatgtgaatcgaacatttggtgtgacgattatgatgattacacatgaa
atgagcgtaattcaaaaaatttgtcatcgtgtagctgtcatggaaaatggcgaagtgata
gaaatggggacagttaaagatgtctttagtcatccacaaacgaacactgcaaaaaatttc
gtttcgacggtgattaacactgagccttcaaaagagttacgggcctcttttaactcgaga
aaagattcaaatttcacagattataaactgtttttagactctgaacaaattcaattgcca
atattgaacgagcttatcaacgagcatcatcttaacgttaacgtattattttcttctatg
tcagaaattcaagatgaaacggtttgttatttgtggttgagatttgagcatgatgagtca
tttaatgattttaaacttactgattacctttcaaaacgacatattcggtatgaggaggtt
atataa

DBGET integrated database retrieval system