KEGG   Staphylococcus epidermidis ATCC 12228: SE2333Help
Entry
SE2333            CDS       T00110                                 

Definition
(RefSeq) NADH dehydrogenase subunit 5
  KO
K05577  NAD(P)H-quinone oxidoreductase subunit 5 [EC:1.6.5.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00190  Oxidative phosphorylation
sep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SE2333
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     SE2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M Proton_antipo_N
Motif
Other DBs
NCBI-GeneID: 1057246
NCBI-ProteinID: NP_765888
UniProt: A0A0H2VKV5
Position
complement(2416221..2417717)
Genome map
AA seq 498 aa AA seqDB search
MLSSELILFMFFITLVIAILSGLIFLNHRVPIQYIKFHIYLLVLPIITGLSGLIFFGERA
NVGPFVVDHLTWLMMTFILTLGFIIQKFSMRYLIGDMHYRKYFPFFTLITAFASLAWLSG
DLRLMTMFWGATLFVLTRLIKVNKLWKVPREAARISAWSFILAWLSLLIAVILLYIATGD
WYIYSNMSDDNAINYGMRLCINLLIVLAVIIPAAQFPFQGWLIESVAAHTPVSAIMHAGI
VNAGGVILTRFSPVFNDEIAISLLLIIASISVLLGSGISLVHVDYKRQLVGSTISQMGFM
LVQCALGAYSAAIVHLILHGVFKATLFLQSGSVVKRFNIPTPPSVKKSYGWLVFGRLLAI
LIAIIFWLNSDRHAYDVLSALILAWSLMVSWNQLVAFSHGLIGRVIGVCMIIVVVIVYII
THHYFFTTLSNVDIHIVSPPLISIILSIAIIVFGSMLSIWVSRRRESKAFAKLYLWLIKV
GEAKTQSIESHPSYLKRF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgttaagttcagagttaattttgtttatgttttttattacacttgtcattgctatactg
agtggattaatatttttgaatcatcgagttcccattcaatatattaaatttcatatatat
ttacttgttttacctatcattacgggattaagtggattaatatttttcggtgaaagggcg
aatgttggaccttttgtagttgatcatcttacttggttaatgatgacatttattttgact
ttaggctttatcattcaaaagttttctatgcgttatttaattggcgacatgcattaccgt
aaatattttccgttttttacattaattactgcatttgcttcattggcatggttaagtgga
gacttaaggttaatgaccatgttttggggtgcaacattatttgtgttaacacggctcatt
aaagttaacaaattatggaaggtgcctagggaagcagcaagaatttcagcttggtcattt
atattggcatggttgtcgttattgattgctgtcattttattgtatatcgctacaggagat
tggtatatttattcgaatatgtcagatgataatgcaatcaattatggaatgcgtctctgt
atcaatttacttattgttttagctgtgattattccggcggcacaatttccatttcaaggc
tggcttattgaatctgtagctgcgcatacgccagtttcagctattatgcacgctggtatt
gttaatgctggtggcgttattcttacacgcttttctccggtatttaatgacgaaatagcc
atttcactgttattaattattgcaagtatttcagtattgttgggttctggaatcagtctt
gtgcatgttgattacaagagacaacttgtaggttctacgataagtcaaatgggttttatg
ttagtacaatgtgcgcttggggcatattctgcggcgatagtacatttaatattgcatggt
gtgtttaaagcgacattatttctacaatcgggttctgttgttaaaagatttaacattcct
acgcctccatctgttaaaaaatcatatggctggcttgtatttggtcgtctactagctatt
cttatagcgataatattttggttgaatagtgatagacatgcatatgatgtattaagcgct
cttatattagcttggtcgttaatggtgtcatggaatcaattagttgcttttagtcatgga
ctcatcggaagagtcatcggagtatgtatgattattgttgtagtaattgtttatattatt
acgcatcattatttcttcacgacattaagtaacgttgatattcatattgtttcaccacca
ctcataagtattattctatcgattgctattatagttttcggcagtatgttaagcatatgg
gtatcacggcgaagagaatcaaaggcatttgcgaagttatacttgtggcttattaaagta
ggagaggctaaaacccaatctatagaaagtcatccatcatatttaaaacgattttag

DBGET integrated database retrieval system