KEGG   Staphylococcus epidermidis ATCC 12228: SE2333Help
Entry
SE2333            CDS       T00110                                 

Definition
NADH dehydrogenase subunit 5
Orthology
K05577  
NAD(P)H-quinone oxidoreductase subunit 5 [EC:1.6.5.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:sep00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2416221..2417717)
Genome map
AA seq 498 aa AA seqDB search
MLSSELILFMFFITLVIAILSGLIFLNHRVPIQYIKFHIYLLVLPIITGLSGLIFFGERA
NVGPFVVDHLTWLMMTFILTLGFIIQKFSMRYLIGDMHYRKYFPFFTLITAFASLAWLSG
DLRLMTMFWGATLFVLTRLIKVNKLWKVPREAARISAWSFILAWLSLLIAVILLYIATGD
WYIYSNMSDDNAINYGMRLCINLLIVLAVIIPAAQFPFQGWLIESVAAHTPVSAIMHAGI
VNAGGVILTRFSPVFNDEIAISLLLIIASISVLLGSGISLVHVDYKRQLVGSTISQMGFM
LVQCALGAYSAAIVHLILHGVFKATLFLQSGSVVKRFNIPTPPSVKKSYGWLVFGRLLAI
LIAIIFWLNSDRHAYDVLSALILAWSLMVSWNQLVAFSHGLIGRVIGVCMIIVVVIVYII
THHYFFTTLSNVDIHIVSPPLISIILSIAIIVFGSMLSIWVSRRRESKAFAKLYLWLIKV
GEAKTQSIESHPSYLKRF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgttaagttcagagttaattttgtttatgttttttattacacttgtcattgctatactg
agtggattaatatttttgaatcatcgagttcccattcaatatattaaatttcatatatat
ttacttgttttacctatcattacgggattaagtggattaatatttttcggtgaaagggcg
aatgttggaccttttgtagttgatcatcttacttggttaatgatgacatttattttgact
ttaggctttatcattcaaaagttttctatgcgttatttaattggcgacatgcattaccgt
aaatattttccgttttttacattaattactgcatttgcttcattggcatggttaagtgga
gacttaaggttaatgaccatgttttggggtgcaacattatttgtgttaacacggctcatt
aaagttaacaaattatggaaggtgcctagggaagcagcaagaatttcagcttggtcattt
atattggcatggttgtcgttattgattgctgtcattttattgtatatcgctacaggagat
tggtatatttattcgaatatgtcagatgataatgcaatcaattatggaatgcgtctctgt
atcaatttacttattgttttagctgtgattattccggcggcacaatttccatttcaaggc
tggcttattgaatctgtagctgcgcatacgccagtttcagctattatgcacgctggtatt
gttaatgctggtggcgttattcttacacgcttttctccggtatttaatgacgaaatagcc
atttcactgttattaattattgcaagtatttcagtattgttgggttctggaatcagtctt
gtgcatgttgattacaagagacaacttgtaggttctacgataagtcaaatgggttttatg
ttagtacaatgtgcgcttggggcatattctgcggcgatagtacatttaatattgcatggt
gtgtttaaagcgacattatttctacaatcgggttctgttgttaaaagatttaacattcct
acgcctccatctgttaaaaaatcatatggctggcttgtatttggtcgtctactagctatt
cttatagcgataatattttggttgaatagtgatagacatgcatatgatgtattaagcgct
cttatattagcttggtcgttaatggtgtcatggaatcaattagttgcttttagtcatgga
ctcatcggaagagtcatcggagtatgtatgattattgttgtagtaattgtttatattatt
acgcatcattatttcttcacgacattaagtaacgttgatattcatattgtttcaccacca
ctcataagtattattctatcgattgctattatagttttcggcagtatgttaagcatatgg
gtatcacggcgaagagaatcaaaggcatttgcgaagttatacttgtggcttattaaagta
ggagaggctaaaacccaatctatagaaagtcatccatcatatttaaaacgattttag

DBGET integrated database retrieval system