KEGG   Staphylococcus epidermidis ATCC 12228: SE2345Help
Entry
SE2345            CDS       T00110                                 

Definition
integrase-like protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2425928..2426455
Genome map
AA seq 175 aa AA seqDB search
MRIGELLAIQPENIDFKNKKLIIDGTIHWRKEGNNLGFKDTTKTALSYRTISLTTRSCDI
LRKVMLEYKKAFQWKNMYVDRDFIFTNHKGNPISLTSINRNIQIAAKNVGIKKHITSHTM
RHSHISLLSQLGISLRAIMDRVGHTDHKTTLQIYSHVTEQMDKDMMSKLEKVGIN
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcgtataggagaacttttagcaatacaaccagaaaacattgatttcaaaaacaaaaaa
cttatcattgatggcactatacattggcgtaaagagggtaacaacctcggttttaaagat
actacaaaaacagctttatcttatcgaactatctctctgactactcgaagttgtgatatt
ttacgtaaagttatgttagagtataagaaagcatttcagtggaaaaatatgtatgtagat
agagattttatatttactaatcataaaggaaaccctatatcacttacatcaatcaacaga
aacatacaaattgctgcaaagaatgtaggtattaaaaagcatataaccagccatactatg
cgtcatagtcacatatcattattatcgcaattaggtatatcactgcgtgcaattatggat
cgtgtaggccatacagatcataagactaccctacagatatacagtcatgttactgaacaa
atggataaagatatgatgagtaagttagagaaagtaggtattaattaa

DBGET integrated database retrieval system