KEGG   Staphylococcus epidermidis ATCC 12228: SE2347Help
Entry
SE2347            CDS       T00110                                 

Gene name
guaA
Definition
GMP synthase (EC:6.3.5.2)
Orthology
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sep00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2427604..2429145)
Genome map
AA seq 513 aa AA seqDB search
MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKRMNPKGIILSGGP
NSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERANEREYGKATINAKSDEL
FFGLPSEQTVWMSHSDKVIEIPEGFEVIADSPSTNYAAIEDKKRRIYGVQFHPEVRHTEY
GNDLLRNFVRRVCNCTGEWTMENFIEIEIEKIRQQVGNRKVLCAMSGGVDSSVVAVLLHK
AIGEQLTCIFVDHGLLRKGEGDMVMEQFGEGFDMNIIRVNAQERFMSKLKGVSDPERKRK
IIGNEFVYVFDDEAAKLTDVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFEL
IEPINTLFKDEVRALGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILR
EVIREEGLERDIWQYFTVLPGIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEV
LQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcgaaagagcaagagctgattcttgttttagactttggtagccaatataac
cagttaattacgcgtcgtatccgtgagatgggcgtttatagtgaattacatgatcacgaa
atttctattgaagaaattaaacgaatgaatcctaaaggtatcattctttcaggtggtcca
aattcagtgtatgaagaggggtcatttaccatcgaccctgaaatttacaatttaggtatt
ccagttttaggtatttgttatggtatgcaattaacgactaagcttttaggtggtaaagtt
gagcgtgccaatgagcgtgaatatggcaaagctacaattaacgctaaatcagatgaactt
ttctttggcttaccttctgaacaaacagtatggatgagtcattctgataaagtaattgaa
attcctgaaggatttgaagtgattgcagatagtccaagtactaattatgcagctattgaa
gataaaaaacgtcgcatttacggtgtacaattccatccagaagtacgtcacactgaatat
gggaacgacttactaagaaacttcgtccgccgtgtttgtaattgtacaggtgaatggacg
atggagaatttcattgaaattgaaattgagaaaatccgtcaacaagtaggtaatcgtaaa
gtattatgtgcaatgagtggtggagtagattcatccgtagttgctgtacttttacataag
gcaatcggcgagcaattaacatgtatttttgtggaccatggtctattacgtaaaggtgaa
ggtgacatggtcatggagcaattcggtgaaggttttgatatgaatattattcgtgttaat
gctcaagaacgcttcatgagtaaactaaaaggtgtgtctgatccagaacgtaaacgtaaa
atcattggtaatgagtttgtatatgtctttgatgacgaagctgcgaaattaacagatgta
gatttcttagctcaaggtacgttatatacggatgtgattgaatcaggtactaagacagct
caaacaattaaatctcaccataatgtaggtggattacctgaagacatggaatttgaactt
attgaaccaatcaatacattattcaaagatgaagtgcgcgcattaggaatagaattaggt
atacctgaacacttagtttggagacagccgttcccaggacctggattaggtatccgtgta
cttggagaaattactgaagataagcttgaaattgttcgtgaatcagatgcgattttacgt
gaagtgattcgtgaggaaggtcttgaaagagatatctggcaatactttacagtacttcca
ggtattcaatcggtcggtgtcatgggagactaccgtacgtatgatcatactgtaggtatt
cgtgcggtaacatccatcgatggcatgactagtgactttgctagaattgattgggaagtc
ttacaaaagatttcaagtcgaattgtcaatgaggtggaccacgttaatcgcgttgtctat
gacattacctctaagccaccaagtacaattgagtgggaataa

DBGET integrated database retrieval system