KEGG   Staphylococcus epidermidis ATCC 12228: SE2347Help
Entry
SE2347            CDS       T00110                                 

Gene name
guaA
Definition
GMP synthase (EC:6.3.5.2)
Orthology
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SE2347 (guaA)
Enzymes [BR:sep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     SE2347 (guaA)
Peptidases [BR:sep01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   SE2347 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2427604..2429145)
Genome map
AA seq 513 aa AA seqDB search
MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKRMNPKGIILSGGP
NSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERANEREYGKATINAKSDEL
FFGLPSEQTVWMSHSDKVIEIPEGFEVIADSPSTNYAAIEDKKRRIYGVQFHPEVRHTEY
GNDLLRNFVRRVCNCTGEWTMENFIEIEIEKIRQQVGNRKVLCAMSGGVDSSVVAVLLHK
AIGEQLTCIFVDHGLLRKGEGDMVMEQFGEGFDMNIIRVNAQERFMSKLKGVSDPERKRK
IIGNEFVYVFDDEAAKLTDVDFLAQGTLYTDVIESGTKTAQTIKSHHNVGGLPEDMEFEL
IEPINTLFKDEVRALGIELGIPEHLVWRQPFPGPGLGIRVLGEITEDKLEIVRESDAILR
EVIREEGLERDIWQYFTVLPGIQSVGVMGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEV
LQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcgaaagagcaagagctgattcttgttttagactttggtagccaatataac
cagttaattacgcgtcgtatccgtgagatgggcgtttatagtgaattacatgatcacgaa
atttctattgaagaaattaaacgaatgaatcctaaaggtatcattctttcaggtggtcca
aattcagtgtatgaagaggggtcatttaccatcgaccctgaaatttacaatttaggtatt
ccagttttaggtatttgttatggtatgcaattaacgactaagcttttaggtggtaaagtt
gagcgtgccaatgagcgtgaatatggcaaagctacaattaacgctaaatcagatgaactt
ttctttggcttaccttctgaacaaacagtatggatgagtcattctgataaagtaattgaa
attcctgaaggatttgaagtgattgcagatagtccaagtactaattatgcagctattgaa
gataaaaaacgtcgcatttacggtgtacaattccatccagaagtacgtcacactgaatat
gggaacgacttactaagaaacttcgtccgccgtgtttgtaattgtacaggtgaatggacg
atggagaatttcattgaaattgaaattgagaaaatccgtcaacaagtaggtaatcgtaaa
gtattatgtgcaatgagtggtggagtagattcatccgtagttgctgtacttttacataag
gcaatcggcgagcaattaacatgtatttttgtggaccatggtctattacgtaaaggtgaa
ggtgacatggtcatggagcaattcggtgaaggttttgatatgaatattattcgtgttaat
gctcaagaacgcttcatgagtaaactaaaaggtgtgtctgatccagaacgtaaacgtaaa
atcattggtaatgagtttgtatatgtctttgatgacgaagctgcgaaattaacagatgta
gatttcttagctcaaggtacgttatatacggatgtgattgaatcaggtactaagacagct
caaacaattaaatctcaccataatgtaggtggattacctgaagacatggaatttgaactt
attgaaccaatcaatacattattcaaagatgaagtgcgcgcattaggaatagaattaggt
atacctgaacacttagtttggagacagccgttcccaggacctggattaggtatccgtgta
cttggagaaattactgaagataagcttgaaattgttcgtgaatcagatgcgattttacgt
gaagtgattcgtgaggaaggtcttgaaagagatatctggcaatactttacagtacttcca
ggtattcaatcggtcggtgtcatgggagactaccgtacgtatgatcatactgtaggtatt
cgtgcggtaacatccatcgatggcatgactagtgactttgctagaattgattgggaagtc
ttacaaaagatttcaagtcgaattgtcaatgaggtggaccacgttaatcgcgttgtctat
gacattacctctaagccaccaagtacaattgagtgggaataa

DBGET integrated database retrieval system