KEGG   Staphylococcus epidermidis ATCC 12228: SE2358Help
Entry
SE2358            CDS       T00110                                 

Definition
alkyl hydroperoxide reductase
Orthology
K03387  
alkyl hydroperoxide reductase subunit F [EC:1.6.4.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2440012..2441535
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLQQLLELMEGDVEFVASLGSDDKSNELKELLNEIAEMSAHITITEKSLKRT
PSFSVNRPGEETGITFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKGLEGPFHFE
TFVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFREESENIMAVPAVFLDGQEFGNG
RMTVQDILTKLGSTQDASEFNDKDPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAEHIAQYDIDTMTGIRATNIEKTDSAIRVTLEND
AVLESKTVIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVKHVTLFEYASELKADSVLQERLRSLPNVDIKTSAKTTEVIGDDYVTGISYED
MTTGESQVVNLDGIFVQIGLVPNTSWLQNAVELNERGEVMINRDNATNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaagcaacaattacaacaattacttgagcttatggaaggcgac
gttgaattcgttgccagcctaggctctgatgataaatcaaacgaactcaaagaattatta
aatgagattgctgagatgtcagcacacataacaataactgaaaaatctttaaaacgtaca
ccaagtttttcagttaatcgccctggtgaagaaacaggtattacattcgctggcatacct
ttaggccatgaattcaactctttagtattagctatactacaagtgagtggtcgcgcacct
aaagaaaagcaatccattatcgatcaaattaaagggctcgaaggtccatttcatttcgaa
acctttgtaagtcttacttgtcaaaagtgtcctgacgtcgttcaagcattaaacctaatg
agtgttattaatcctaacattactcatactatgattgatggcgctgttttccgtgaagaa
tctgaaaacattatggcagttcctgccgtcttcttagatggtcaagaatttggtaatgga
cgcatgacagttcaagatattttaactaaattaggaagcacgcaagatgcctctgaattc
aacgataaagatccttatgacgtgttaatcgttggtggcggacctgcaagtggtagtgct
gcaatttatacagcacgtaaagggctacgtacaggtattgtcgctgatcgaattggtggt
caagttaatgatactgctggtatcgagaacttcatcactgttaaagaaacgacaggttca
gagttctcatcaaatcttgcagaacatattgcacaatatgatattgatacaatgactggt
attcgtgctacaaatatcgaaaaaacagattcagctattcgcgtaactttagaaaatgat
gctgttttagaaagtaaaactgtcatcatttccacaggtgcaagttggcgtaaactaaac
atcccaggcgaagaccgtctaatcaataaaggcgtggctttctgccctcactgtgacgga
cctttatttgaaaataaagatgttgctgtcatcggtggtggtaactctggtgtagaagca
gctattgatttagccggcatcgttaaacacgtaacattatttgaatacgcttctgaatta
aaagctgatagcgtattacaagaacgtttacgctcactacctaatgttgatattaaaacg
agtgctaaaacaacagaagtaattggtgacgattacgttacaggtattagctatgaagat
atgactaccggagagtcacaagtagttaatttagatggaatatttgtacagattggatta
gttcctaatacatcttggttgcaaaatgctgtcgaattaaatgaacgtggcgaggttatg
attaatcgcgataacgcaacaaacgttcctggtatctttgcagctggtgacgttaccgat
caaaaaaataagcaaataattatttctatgggtgctggtgctaatgccgcacttaatgca
ttcgattatataattagaaattaa

DBGET integrated database retrieval system