KEGG   Staphylococcus epidermidis ATCC 12228: SE2364Help
Entry
SE2364            CDS       T00110                                 

Definition
phosphoglycerate mutase Gpm3p
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE2364
   01230 Biosynthesis of amino acids
    SE2364
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE2364
  Energy metabolism
   00680 Methane metabolism
    SE2364
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE2364
Enzymes [BR:sep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SE2364
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SE2364
  Exosomal proteins of melanoma cells
   SE2364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2443376..2443966)
Genome map
AA seq 196 aa AA seqDB search
MEIYLVRHGESQSNYDNKHGYLYFCGQLDVPLTERGIKSAKELSVYFKNKYIDNIYLSDL
KRTRQTYEELFPYDIPTIYTKTLRERSLGVFEGENKEEVCKDKRFEKYFRDPNYKYFRHS
FSQKAPQGESYQDVYDRVVTFIENELNQQQKRVVIVAHQVVIRCFFVYFKMITKEEALAT
EIHNCYPYLIKKEMKF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatttagtgaggcatggtgagtcacagtccaattatgataataaacacggg
tatctatatttttgtggacagttagacgtccctttgacggaaaggggtataaaaagcgct
aaagaactatctgtttattttaaaaataaatacattgacaatatatatttatcagattta
aaaagaacaaggcaaacgtatgaggagctatttccttatgatattccaacaatatataca
aagacgttaagagagcgttcgttaggtgtttttgaaggggaaaataaagaagaagtttgt
aaagacaaacggttcgaaaaatatttccgtgatcctaattataaatactttagacatagc
ttttcgcaaaaagcaccacaaggagaaagttatcaagatgtctatgatagagtggttact
ttcattgaaaatgagcttaatcaacagcagaaacgtgtagtgatagttgcgcaccaagtt
gtaattagatgttttttcgtctattttaaaatgataactaaggaagaagccttagcgacg
gaaattcataattgctatccatatttaattaaaaaagaaatgaagttttga

DBGET integrated database retrieval system