KEGG   Staphylococcus epidermidis ATCC 12228: SE2364Help
Entry
SE2364            CDS       T00110                                 

Definition
phosphoglycerate mutase Gpm3p
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE2364
   01230 Biosynthesis of amino acids
    SE2364
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE2364
  Energy metabolism
   00680 Methane metabolism
    SE2364
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE2364
Enzymes [BR:sep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SE2364
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SE2364
  Exosomal proteins of melanoma cells
   SE2364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2443376..2443966)
Genome map
AA seq 196 aa AA seqDB search
MEIYLVRHGESQSNYDNKHGYLYFCGQLDVPLTERGIKSAKELSVYFKNKYIDNIYLSDL
KRTRQTYEELFPYDIPTIYTKTLRERSLGVFEGENKEEVCKDKRFEKYFRDPNYKYFRHS
FSQKAPQGESYQDVYDRVVTFIENELNQQQKRVVIVAHQVVIRCFFVYFKMITKEEALAT
EIHNCYPYLIKKEMKF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatttagtgaggcatggtgagtcacagtccaattatgataataaacacggg
tatctatatttttgtggacagttagacgtccctttgacggaaaggggtataaaaagcgct
aaagaactatctgtttattttaaaaataaatacattgacaatatatatttatcagattta
aaaagaacaaggcaaacgtatgaggagctatttccttatgatattccaacaatatataca
aagacgttaagagagcgttcgttaggtgtttttgaaggggaaaataaagaagaagtttgt
aaagacaaacggttcgaaaaatatttccgtgatcctaattataaatactttagacatagc
ttttcgcaaaaagcaccacaaggagaaagttatcaagatgtctatgatagagtggttact
ttcattgaaaatgagcttaatcaacagcagaaacgtgtagtgatagttgcgcaccaagtt
gtaattagatgttttttcgtctattttaaaatgataactaaggaagaagccttagcgacg
gaaattcataattgctatccatatttaattaaaaaagaaatgaagttttga

DBGET integrated database retrieval system