KEGG   Staphylococcus epidermidis ATCC 12228: SE2377Help
Entry
SE2377            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K03442  
small conductance mechanosensitive channel
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2450437..2451312)
Genome map
AA seq 291 aa AA seqDB search
MNQLKHILSSLFEPLTKVETYENLITKVIMILIYILVAIVVIAILNKIIEQAFKIQNKSK
KGNKKRSKTLISLVQNIVKYIVWFVVITTILSKFGISVEGIIASAGVVGIAVGFGAQTIV
KDIITGFFIIFENQFDVGDYVKINSSGTTVAEGTVKSIGLRSTRINTISGELTILPNGSM
GEITNFSITNGTAIVELPVSVDENIDQVEKKLNRLFVSLRSKYYLFVSDPVVDGIDAIES
NKVTIRISAETIPGEGFSGARIIRKEAQKMFRQEGIRMPQPVISNYNEEKS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacttaaacatattttatcttcattgttcgaacctttaacaaaggttgaaaca
tatgaaaatttaattactaaagtaataatgattttaatttatatccttgtagcaattgtt
gttatagcaattttgaataagattattgagcaagcatttaaaattcaaaataaaagcaaa
aaaggaaataaaaaacgttcaaaaacactgatttctcttgtacaaaacatagtaaaatat
atcgtatggtttgttgttatcacaacaattttaagtaagtttggtattagcgtcgaaggt
atcatcgctagtgctggagttgtaggtattgcagttggtttcggtgcgcaaacaatagta
aaagatattattacaggtttctttattatctttgaaaatcaatttgatgtgggtgactat
gttaaaatcaatagttcaggaactacggtagcagaaggtactgtgaaatctattggttta
agatcaacgcgaattaatacaatttcgggagaactgactattttacctaatggtagcatg
ggggaaattacgaacttttcaattacaaatgggactgctattgtagaactaccagtatca
gttgatgaaaatatagatcaagttgaaaagaaactcaatcgtttatttgtttctttacgt
agtaaatattacttatttgtcagcgatccagttgttgatggcattgatgcgatagaatct
aataaggttactatacgaatttcagcggaaacaattcctggtgaaggattttcaggcgct
cgtattattcgtaaggaagctcaaaaaatgtttagacaagaaggtattcgcatgccacaa
ccagtcatttcaaattataatgaagaaaaaagctaa

DBGET integrated database retrieval system