KEGG   Staphylococcus epidermidis ATCC 12228: SE2377Help
Entry
SE2377            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
  KO
K03442  
small conductance mechanosensitive channel
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Transporters [BR:sep02000]
 Other Transporters
  Pores ion channels [TC:1]
   SE2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2450437..2451312)
Genome map
AA seq 291 aa AA seqDB search
MNQLKHILSSLFEPLTKVETYENLITKVIMILIYILVAIVVIAILNKIIEQAFKIQNKSK
KGNKKRSKTLISLVQNIVKYIVWFVVITTILSKFGISVEGIIASAGVVGIAVGFGAQTIV
KDIITGFFIIFENQFDVGDYVKINSSGTTVAEGTVKSIGLRSTRINTISGELTILPNGSM
GEITNFSITNGTAIVELPVSVDENIDQVEKKLNRLFVSLRSKYYLFVSDPVVDGIDAIES
NKVTIRISAETIPGEGFSGARIIRKEAQKMFRQEGIRMPQPVISNYNEEKS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacttaaacatattttatcttcattgttcgaacctttaacaaaggttgaaaca
tatgaaaatttaattactaaagtaataatgattttaatttatatccttgtagcaattgtt
gttatagcaattttgaataagattattgagcaagcatttaaaattcaaaataaaagcaaa
aaaggaaataaaaaacgttcaaaaacactgatttctcttgtacaaaacatagtaaaatat
atcgtatggtttgttgttatcacaacaattttaagtaagtttggtattagcgtcgaaggt
atcatcgctagtgctggagttgtaggtattgcagttggtttcggtgcgcaaacaatagta
aaagatattattacaggtttctttattatctttgaaaatcaatttgatgtgggtgactat
gttaaaatcaatagttcaggaactacggtagcagaaggtactgtgaaatctattggttta
agatcaacgcgaattaatacaatttcgggagaactgactattttacctaatggtagcatg
ggggaaattacgaacttttcaattacaaatgggactgctattgtagaactaccagtatca
gttgatgaaaatatagatcaagttgaaaagaaactcaatcgtttatttgtttctttacgt
agtaaatattacttatttgtcagcgatccagttgttgatggcattgatgcgatagaatct
aataaggttactatacgaatttcagcggaaacaattcctggtgaaggattttcaggcgct
cgtattattcgtaaggaagctcaaaaaatgtttagacaagaaggtattcgcatgccacaa
ccagtcatttcaaattataatgaagaaaaaagctaa

DBGET integrated database retrieval system