KEGG   Staphylococcus epidermidis ATCC 12228: SE2380Help
Entry
SE2380            CDS       T00110                                 

Definition
cystathionine beta-lyase
Orthology
K01760  
cystathionine beta-lyase [EC:4.4.1.8]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SE2380
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SE2380
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SE2380
Enzymes [BR:sep01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.8  cystathionine beta-lyase
     SE2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2454138..2455313
Genome map
AA seq 391 aa AA seqDB search
MSLSKETEVIFDVRRGKDYDSANPPLYDSSTFHQKVLGGETQYDYARSGNPNRTLLEEKL
ARLEGGKYAFAYASGIAAISAVLLTLNAGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
NATHIDHITEAIQSNTKLIYVETPSNPLFKITDIHAVATLAKEHKILLAVDNTFMTPLGQ
SPLALGADIVIHSATKFLGGHSDLIAGAAITNNREVANALYLLQNGTGTALSAYDSWALA
KHLKTLPVRFKQSVHNAERLVQFLSQREEISEVYYPGNNPTHLKQASTGGAVIGFRLKDE
SKAQKFVDSLTLPLVSVSLGGVETILSHPATMSHAAVPEDVRRERGITFGLFRLSVGLEN
PEELIADFNYALKEAFNESFTEPIKEQRFSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatctaaagaaacagaagtaatattcgatgtgcgtagaggtaaagactacgac
tcagctaacccgccactttacgattcatctacattccatcaaaaagtgttaggcggtgag
actcaatatgattatgcacgaagtggtaaccctaaccgaactttacttgaagagaaactt
gcacgtttagaaggtggtaaatatgcatttgcttatgcttcaggcattgctgcaatttca
gccgttttactcacattaaacgcaggggatcatgttattttacctgatgatgtttacggg
ggcacatttagattaactgaacaaatactcaatcgattcaatattgaatttactacagtt
aacgctacacatatagatcatatcactgaagctattcaatcaaacacaaaactcatctat
gtagagacgccttcaaatccacttttcaaaattacagatattcatgctgtagcaacgcta
gcaaaggaacataagatactattagctgttgataatacgtttatgacacctttgggtcaa
tcacctttagcactaggcgctgacatagttattcatagtgcaactaaatttctaggtgga
catagcgatttaattgcaggtgcagcaattactaataatagagaggttgcaaatgcattg
tacttattacagaacggcacgggcacagccctttctgcatatgatagttgggcacttgca
aaacatcttaaaacattaccagttcgttttaaacaatctgttcataatgctgaacgtctt
gttcaatttttgagtcaaagagaggagatttctgaggtgtattacccaggaaataatcct
acacatctcaagcaagcttcaactggaggtgcagtgataggtttccgacttaaagatgaa
tctaaagcacaaaagttcgtcgattctcttactttaccacttgtatcagtgagtctcggt
ggtgtagaaactatcctatcacatcccgcaacaatgtctcatgcagcagtgccagaagat
gtgagacgtgaacgtggcatcactttcgggttattccgtttaagtgtaggtcttgagaat
ccagaagaactcatcgcagattttaactacgctttaaaggaggctttcaatgagtcattt
actgaaccaattaaagagcaacgttttagtagctga

DBGET integrated database retrieval system