KEGG   Staphylococcus epidermidis ATCC 12228: SE2395Help
Entry
SE2395            CDS       T00110                                 

Definition
Ser-Asp rich fibrinogen-binding,bone sialoprotein-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2470982..2475883)
Genome map
AA seq 1633 aa AA seqDB search
MKKRRQGPINKRVDFLSNKVNKYSIRKFTVGTASILVGATLMFGAADNEAKAAEDNQLES
ASKEEQKGSRDNESSKLNQVDLDNGSHSSEKTTNVNNATEVKKVEAPTTSDVSKPKANEA
VVTNESTKPKTTEAPTVNEESIAETPKTSTTQQDSTEKNNPSLKDNLNSSSTTSKESKTD
EHSTKQAQMSTNKSNLDTNDSPTQSEKTSSQANNDSTDNQSAPSKQLDSKPSEQKVYKTK
FNDEPTQDVEHTTTKLKTPSISTDSSVNDKQDYTRSAVASLGVDSNETEAITNAVRDNLD
LKAASREQINEAIIAEALKKDFSNPDYGVDTPLALNTSQSKNSPHKSASPRMNLMSLAAE
PNSGKNVNDKVKITNPTLSLNKSNNHANNVIWPTSNEQFNLKANYELDDSIKEGDTFTIK
YGQYIRPGGLELPAIKTQLRSKDGSIVANGVYDKTTNTTTYTFTNYVDQYQNITGSFDLI
ATPKRETAIKDNQNYPMEVTIANEVVKKDFIVDYGNKKDNTTTAAVANVDNVNNKHNEVV
YLNQNNQNPKYAKYFSTVKNGKFIPGEVKVYEVTDTNAMVDSFNPDLNSSNVKDVTSQFT
PKVSADGTRVDINFARSMANGKKYIVTQAVRPTGTGNVYTEYWLTRDGTTNTNDFYRGTK
STTVTYLNGSSTAQGDNPTYSLGDYVWLDKNKNGVQDDDEKGLAGVYVTLKDSNNRELQR
VTTDQSGHYQFDNLQNGTYTVEFAIPDNYTPSPANNSTNDAIDSDGERDGTRKVVVAKGT
INNADNMTVDTGFYLTPKYNVGDYVWEDTNKDGIQDDNEKGISNVKVTLKNKNGDTIGTT
TTDSNGKYEFTGLENGDYTIEFETPEGYTPTKQNSGSDEGKDSNGTKTTVTVKDADNKTI
DSGFYKPIYNLGDYVWEDTNKDGIQDDSEKGISGVKVTLKDKNGNAIGTTTTDASGHYQF
KGLENGSYTVEFETPSGYTPTKANSGQDITVDSNGITTTGIINGADNLTIDSGFYKTPKY
SVGDYVWEDTNKDGIQDDNEKGISGVKVTLKDEKGNIISTTTTDENGKYQFDNLDSGNYI
IHFEKPEGMTQTTANSGNDDEKDADGEDVRVTITDHDDFSIDNGYFDDDSDSDSDADSDS
DSDSDSDADSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSDADSDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDS
DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDSDSDS
DADSDSDSDSDSDSDSDSDADSDSDSDSDSDAESDSDSDSDSDSDSDSDSDSDSDSDSDS
DSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSYSDSDSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDKNAKDKLPDTGANEDHDSKGTLLGTLFAGLGAL
LLGRRRKKDNKEK
NT seq 4902 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagaagacaaggaccaattaacaagagagtggattttctatccaacaaggta
aacaagtactcgattaggaagttcacagtaggtacagcttcaatactcgtgggtgctacg
ttaatgtttggtgccgcagacaatgaggctaaagcggctgaagacaatcaattagaatca
gcttcaaaagaagaacagaaaggtagtcgtgataatgaaagctcaaaacttaatcaagtc
gatttagacaacggatcacatagttctgagaaaacaacaaatgtaaacaatgcaactgaa
gtaaaaaaagttgaagcaccaacgacaagtgacgtatctaagcctaaagctaatgaagca
gtagtgacgaacgagtcaactaaaccaaaaacaacagaagcaccaactgttaatgaggaa
tcaatagctgaaacacccaaaacctcaactacacaacaagattcgactgagaagaataat
ccatctttaaaagataatttaaattcatcctcaacgacatctaaagaaagtaaaacagac
gaacattctactaagcaagctcaaatgtctactaataaatcaaatttagacacaaatgac
tctccaactcaaagtgagaaaacttcatcacaagcaaataacgacagtacagacaatcag
tcagcaccttctaaacaattagattcaaaaccatcagaacaaaaagtatataaaacaaaa
tttaatgatgaacctactcaagatgttgaacacacgacaactaaattaaaaacaccttct
atttcaacagatagttcagtcaatgataagcaagattacacacgaagtgctgtagctagt
ttaggtgttgattctaatgaaacagaagcaattacaaatgcagttagagataatttagat
ttaaaagctgcatctagagaacaaatcaatgaagcaatcattgctgaagcactaaaaaaa
gacttttctaaccctgattatggtgtcgatacgccattagctctgaacacatctcaatca
aaaaattcaccacataagagtgcaagtccacgcatgaatttaatgagtttagctgctgag
cctaatagtggtaaaaatgtgaatgataaagttaaaatcacaaaccctacgctttcactt
aataagagtaataatcacgctaataacgtaatatggccaacaagtaacgaacaatttaat
ttaaaagcaaattatgaattagatgacagcataaaagagggagatacttttactattaag
tatggtcagtatattagaccgggtggtttagaacttcctgcaataaaaactcaactacgt
agtaaggatggctctattgtagctaatggtgtatatgataaaactacaaatacgacgact
tatacatttactaactatgttgatcaatatcaaaatattacaggtagttttgatttaatt
gcgacgcctaagagggaaacagcaattaaggataatcagaattatcctatggaagtgacg
attgctaacgaagtagtcaaaaaagacttcattgtggattatggtaataaaaaggacaat
acaactacagcagcggtagcaaatgtggataatgtaaataataaacataacgaagttgtt
tatctaaaccaaaataaccaaaatcctaaatatgctaaatatttctcaacagtaaaaaat
ggtaaatttataccaggtgaagtgaaagtttacgaagtgacggataccaatgcgatggta
gatagcttcaatcctgatttaaatagttctaatgtaaaagatgtgacaagtcaatttaca
cctaaagtaagtgcagatggtactagagttgatatcaattttgctagaagtatggcaaat
ggtaaaaagtatattgtaactcaagcagtgagaccaacgggaactggaaatgtttatacc
gaatattggttaacaagagatggtactaccaatacaaatgatttttatcgtggaacgaag
tctacaacggtgacttatctcaatggttcttcaacagcacagggggataatcctacatat
agtctaggtgactatgtatggttagataaaaataaaaacggtgttcaagatgatgatgag
aaaggtttagcaggtgtttatgttactcttaaagacagtaacaatagagaattacaacgt
gtaactactgatcaatctggacattatcaatttgataatttacaaaatggaacgtacaca
gtcgagtttgcgattcctgataattatacgccatctcccgcaaataattctacaaatgat
gcaatagattcagatggtgaacgtgatggtacacgtaaagtagttgttgccaaaggaaca
attaataatgctgataatatgactgtagatactggcttttatttaactcctaaatacaat
gtcggagattatgtatgggaagatacaaataaagatggtatccaagatgacaatgaaaag
ggaatttcaaatgtcaaagtgacgttaaaaaataaaaatggagataccattgggacaacg
acaacagattcaaatggtaaatatgaattcacaggtttagagaacggggattacacaata
gaatttgagacgccggaaggctacacaccgactaaacaaaactcgggaagtgacgaaggt
aaagattcaaatggtacgaaaacaacagtcacagtcaaagatgcagataataaaacaata
gactcaggtttctacaagccaatatataacttaggtgactatgtatgggaagatacaaat
aaagatggtattcaagacgacagtgaaaaagggatttctggtgttaaagtgacgttaaaa
gataaaaatggaaatgccattgggacaacgacaacagacgcaagtggtcattatcaattt
aaaggattagaaaatggaagctacacagttgagtttgagacaccatcaggttatacaccg
acaaaagcgaattcaggtcaagatataactgtagattccaacggtataacaacaacaggt
atcattaacggagctgataatctcacaattgatagtggtttctacaaaacaccaaaatat
agtgtcggagattatgtatgggaagatacaaataaagatggtatccaagatgacaatgaa
aaaggaatttctggtgttaaagtaacgttaaaggatgaaaaaggaaatataattagcact
acaacaactgatgaaaatgggaagtatcaatttgataatttagatagtggtaattacatt
attcattttgagaaaccggaaggcatgactcaaactacagcaaattctggaaatgatgat
gaaaaagatgctgatggggaagatgttcgtgtaacgattactgatcatgatgactttagt
atagataatggttattttgacgatgattcagacagtgactcagacgcagatagtgattca
gactccgacagtgactcggacgcagacagcgattctgacgcagacagtgactcagattca
gatagtgattctgactcagacagcgactcggattctgatagtgattcggattccgattca
gacagtgactcagacgcagatagtgattctgacgcagacagtgactcagattcagatagt
gattctgactcagacagcgactcggattctgatagtgattcggattccgattcagacagt
gactcagacgcagatagtgattcggacgcagacagtgactcagacgcagatagtgattcg
gatgcagacagcgactcggattcagatagtgattcggatgcagacagcgactcggattca
gatagtgattcggatgcagacagcgactcggattctgacagtgattcggacgcagacagt
gactcagattcagacagtgattcggacgcagacagcgactcggattctgatagtgattcg
gacgcagacagtgactcagattcagacagtgactcggattcagacagcgattcggattcc
gattcagacagtgactcggattcagacagtgactcagactccgacagtgattccgattca
gatagcgactcagacgcagatagtgattccgattcagatagcgactccgacgcagatagt
gattcggacgcagacagtgactcagattcagacagtgactcagattcagacagtgattcg
gacgcagacagtgactccgactccgacagcgattcagactcagatagtgactcagacgca
gacagtgactcggactcagatagtgattcagatgcagaaagcgattcagactcagatagc
gactccgattcagacagcgactccgactcagacagtgattccgattcagacagcgattcg
gactcagatagtgactcagacgcagatagtgattccgattcagatagcgactccgattct
gatagtgactccgattcagatagcgactccgattcagatagtgattcggacgcagacagt
gactcgtactcagatagtgactccgattcagacagtgattcggattccgatagcgattcg
gattccgatagtgactcggattcagacagtgattcggactcagacagcgactccgattca
gatagtgattccgactcagacagcgattcggattccgatagtgactcggattcagacagt
gattcggactcagacagcgattccgattccgatagtgactcggattcagacagtgattcg
gactcagacagcgattccgattcagacagtgactcggactcagatagtgactccgattca
gacagcgactcggattctgataaaaatgcaaaagataaattacctgatacaggagcaaat
gaagatcatgattctaaaggcacattacttggaactttatttgcaggtttaggagcatta
ttattaggaagacgtcgtaaaaaagataataaagaaaaatag

DBGET integrated database retrieval system