KEGG   Staphylococcus epidermidis ATCC 12228: SE2400Help
Entry
SE2400            CDS       T00110                                 

Definition
vraD protein
Orthology
K11631  
bacitracin transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Two-component system
Staphylococcus aureus infection
Module
Bacitracin transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2400
  Signal transduction
   02020 Two-component system
    SE2400
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    SE2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2480690..2481448
Genome map
AA seq 252 aa AA seqDB search
MAILTANQLSKVYGHKQKYRALNNISFSVEKGEFVAVMGPSGSGKTTLLNVLSSIDTISG
GTVEVEGKEINKLSHKEVANFRKQHLGFIFQDYSVLPTLTVKENIMLPLSVQKFHKYEME
QNYKEVAEALGIYNLGNKYPSEISGGQQQRTAAARAFVHKPTIIFADEPTGALDSKSAQD
LLHRLEDMNKQFNSTIMMVTHDPSAASYAERVIMLKDGDIHSEIYQSNDSKQTFYQEIMK
LQTALGGVSHDI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctattttaacagcaaatcaattatcaaaagtatatggtcacaaacaaaaatatcga
gctttaaataatataagtttttcagttgaaaaaggggaatttgtagctgtcatgggtcct
tctggatcaggtaaaacgactttactcaatgtgttaagttcaatagatactatttcagga
ggaactgtggaagttgaaggtaaagaaattaataaactgagccacaaagaagtggcaaat
tttcgaaaacaacatctcggttttatttttcaagattatagcgttttacccacattaaca
gtaaaagaaaatattatgctaccactctcagtacaaaaattccataaatatgaaatggaa
caaaattataaagaagtggctgaggcattaggtatttataacctgggaaataaatatcca
agtgaaatttctggcggtcagcaacaacgtacggcggcagcccgggcattcgtccataaa
ccaacgattattttcgcagatgaacctactggcgcattagattctaaaagtgctcaagat
ttgttacaccgtctagaagatatgaataaacaatttaattcaaccattatgatggtgaca
catgatccttcagccgctagttacgctgagagagtaattatgttgaaagacggtgatata
cactcagaaatctaccagagtaacgattcaaaacaaacattttaccaagaaattatgaaa
cttcaaaccgcattaggtggtgtcagtcatgacatttaa

DBGET integrated database retrieval system