KEGG   Staphylococcus epidermidis ATCC 12228: SE2400Help
Entry
SE2400            CDS       T00110                                 

Definition
(RefSeq) vraD protein
  KO
K11631  bacitracin transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02010  ABC transporters
sep02020  Two-component system
Module
sep_M00314  Bacitracin transport system
sep_M00737  Bacitracin resistance, VraDE transporter
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2400
  Signal transduction
   02020 Two-component system
    SE2400
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Bacitracin transporter [MD:M00314] [OT]
    SE2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N RsgA_GTPase AAA_16 AAA_21 T2SSE AAA_30 AAA_29 AAA_25 AAA AAA_22 IstB_IS21 AAA_23 AAA_18 AAA_28 Rad17 ATPase_2 MMR_HSR1 ATP_bind_1 NACHT Mg_chelatase AAA_33 Septin cobW NB-ARC AAA_24 AAA_19
Motif
Other DBs
NCBI-GeneID: 1057182
NCBI-ProteinID: NP_765955
UniProt: A0A0H2VJ26
Position
2480690..2481448
Genome map
AA seq 252 aa AA seqDB search
MAILTANQLSKVYGHKQKYRALNNISFSVEKGEFVAVMGPSGSGKTTLLNVLSSIDTISG
GTVEVEGKEINKLSHKEVANFRKQHLGFIFQDYSVLPTLTVKENIMLPLSVQKFHKYEME
QNYKEVAEALGIYNLGNKYPSEISGGQQQRTAAARAFVHKPTIIFADEPTGALDSKSAQD
LLHRLEDMNKQFNSTIMMVTHDPSAASYAERVIMLKDGDIHSEIYQSNDSKQTFYQEIMK
LQTALGGVSHDI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctattttaacagcaaatcaattatcaaaagtatatggtcacaaacaaaaatatcga
gctttaaataatataagtttttcagttgaaaaaggggaatttgtagctgtcatgggtcct
tctggatcaggtaaaacgactttactcaatgtgttaagttcaatagatactatttcagga
ggaactgtggaagttgaaggtaaagaaattaataaactgagccacaaagaagtggcaaat
tttcgaaaacaacatctcggttttatttttcaagattatagcgttttacccacattaaca
gtaaaagaaaatattatgctaccactctcagtacaaaaattccataaatatgaaatggaa
caaaattataaagaagtggctgaggcattaggtatttataacctgggaaataaatatcca
agtgaaatttctggcggtcagcaacaacgtacggcggcagcccgggcattcgtccataaa
ccaacgattattttcgcagatgaacctactggcgcattagattctaaaagtgctcaagat
ttgttacaccgtctagaagatatgaataaacaatttaattcaaccattatgatggtgaca
catgatccttcagccgctagttacgctgagagagtaattatgttgaaagacggtgatata
cactcagaaatctaccagagtaacgattcaaaacaaacattttaccaagaaattatgaaa
cttcaaaccgcattaggtggtgtcagtcatgacatttaa

DBGET integrated database retrieval system