KEGG   Staphylococcus epidermidis ATCC 12228: SE2403Help
Entry
SE2403            CDS       T00110                                 

Definition
glycerol ester hydrolase
Orthology
K01046  
triacylglycerol lipase [EC:3.1.1.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SE2403
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     SE2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2483626..2485671)
Genome map
AA seq 681 aa AA seqDB search
MTNNNRIKRFSIRKYAVGVVSIITGVTIFIGGQQAQAAETSVQHADAHPEDSQTTQQLKN
DKVEETLKASKQGNADSQQVQTIDQSKTNQNNQHSVAESAQLKSDETANQPKKEEGSSVK
QDVQPSKNVNQQDVATQSNERENNDIKDEGQTSKTSNQHIQSSNSHNQSTGTKDSYSEEI
DQPLVKLQKPSNDSTYQTQSKTKQDSSKQLPQEKTTKRQIQTTENEQTTKVDSKKANDTQ
NVEKHTQEPKNDTSTSQKNHQQVATKEQSNRSTTRETQKQSANANQNHQSTHQAQFKNQY
PVVFVHGFLGFAGDNQFSLAPKYWGGTKYNIDRNLTNEGYNVHEANIGAFSSNYDRAVEL
YYYVKGGRVDYGAAHAAKYGHHRYGRTYKGIMRDWEPGKKIHFIGHSMGGQTIRQMEEFL
RNGNQEEIEYQRQHGGTISDLFTGGKDNMVASITTLGTPHNGTPAADKIGTRKLVKETIN
RIGRLSGGKDVDIDLGFSQWGLKQQPNESYIDYAERVSKSKIWNTEDQAVNDLTTQGAEK
INQQTSLNPNIVYTTYTGSATHTGPLGNELPNSSEILLLNLTSRIIGKDANKEIRPNDGV
VPVISSQHPSNQAFKKVDDHTPATDKGVWQVRPVQHDWDHLDLVGMDAFDLTHTGRELGQ
FYLGIMDNIMRIEEADGITNK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaataataatagaataaaaagatttagcattagaaaatacgcagtgggagtagta
tcaattattacaggtgtaacaattttcatcggagggcaacaagctcaagcagctgaaact
tcagtgcaacatgcggatgcacacccagaagactcgcaaacaacacaacaattaaaaaat
gataaggtagaagaaacgttaaaagcttcaaaacaaggtaatgctgatagtcaacaagta
caaacaattgatcaatctaaaacaaatcaaaacaaccaacattctgtagctgaaagtgca
caactgaaaagtgatgagacagctaatcagccaaaaaaagaagaaggtagctcagtaaaa
caagacgtccaaccgtctaaaaatgtaaatcaacaagacgtagctactcaatcaaatgag
agagaaaataatgacataaaagatgaaggtcaaacttcaaagacgagcaatcaacatatc
cagagttctaacagtcataatcaatcaacaggaacaaaagacagctactcagaagaaatc
gaccaaccattagtgaaattacaaaagccgtctaatgattctacatatcaaacacaatca
aaaacaaaacaagatagttctaaacaactccctcaagaaaaaacaacaaaacgtcaaatt
caaacaactgaaaatgaacagacaactaaagttgattctaaaaaagctaatgacactcaa
aatgttgaaaaacatactcaagagcctaaaaatgatacatcaacatcacaaaaaaatcat
caacaagtagctacaaaagaacaatctaatagaagtacaacaagggagacgcaaaagcaa
tcagcaaatgctaatcaaaatcatcagtctacacatcaagcacagttcaaaaaccaatat
ccagtagtatttgtccatggtttcctaggctttgcaggtgataatcaatttagtttagct
ccaaaatattggggtggtacaaaatacaatattgacagaaatttaactaatgagggatac
aatgtacatgaggcaaatattggtgcttttagtagtaactatgatcgcgcagtagaattg
tattactatgtcaaaggaggacgtgttgattacggtgcagcgcatgcagctaaatatggt
catcatcgctatggtcgaacatacaagggcatcatgcgtgattgggaacctggcaaaaaa
attcattttataggtcacagtatgggtggtcaaaccattcgtcaaatggaagaattctta
agaaatggtaaccaagaagaaatagaatatcaacgtcaacatgggggtactatatccgat
ttatttacaggtggtaaagataatatggttgcttcaattactacacttggcacaccacat
aatggtacacctgctgcagataaaattggcacacgtaaacttgtaaaagaaacgattaat
cgtattggtagattaagtggtggtaaagatgtagatatagatttaggtttttctcaatgg
ggattaaaacaacaaccaaatgaaagctacattgattacgcggaacgtgtatccaaaagt
aagatttggaatactgaagatcaagctgttaatgatctgacaacgcaaggtgctgaaaaa
attaatcaacaaacaagtctaaatcctaatattgtctacactacttatacagggtcagcg
actcacacaggacctcttggtaatgaattacctaattctagtgaaattcttttgttgaac
ttaaccagccgtattattggtaaagatgcaaacaaagaaattagaccgaatgatggtgta
gttccagttatatcatcacaacatccttctaatcaagcctttaaaaaagttgatgatcat
acaccagctactgataaaggtgtttggcaagtgagacccgttcaacatgattgggaccat
ttagatttagtaggtatggatgcatttgatttaacacatacaggtagagaattaggtcaa
ttctatctaggtattatggataatatcatgagaatcgaagaagcagacggtattacaaat
aaataa

DBGET integrated database retrieval system