KEGG   Staphylococcus epidermidis ATCC 12228: SE_p102Help
Entry
SE_p102           CDS       T00110                                 

Definition
RepC protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSE-12228-01:1601..2842
Genome map
AA seq 413 aa AA seqDB search
MSYSIVRVSKVKSGTNTTGIQKHVQRENNNYENEDIDHSKTYLNYDLVNANKQNFNNLID
EKIEQNYTGKRKIRTDAIKHIDGLITSDNDFFDNQTPEDTKQFFEYAKEFLEQEYGKDNL
LYATVHMDEKTPHMHYGVVPITDDGRLSAKEVVGNKKALTAFQDRFNEHVKQRGYDLERG
QSRQVTNAKHEQISQYKQKTEYHKQEYERESQKTDHIKQKNDKLMQEYQKSLNTLKKPIN
VPYEQETEKVGGLFSKEIQETGNVVISQKDFNEFQKQIKAAQDISEDYEYIKSGRALDDK
DKEIREKDDLLNKAVERIENADDNFNQLYENAKPLKENIEIALKLLKILLKELERVLGRN
TFAERVNKLTEDEPKLNGLAGNLDKKMNPELYSEQEQQQEQQKNQKRDRGMHL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtcttattccattgttagagtttcaaaagttaaatctggaacaaatacaacgggcata
caaaaacatgttcaaagagaaaataataattatgaaaatgaagatatagaccatagtaaa
acttacttaaattatgatttggtaaatgctaataaacagaattttaataacttgattgat
gaaaaaatcgaacagaattatacaggcaaaagaaaaattagaacagacgcgattaaacac
attgatggtttaattacatcagacaatgatttctttgataatcaaacgccagaagataca
aagcagttttttgaatatgctaaagagtttttagaacaagaatacggtaaagataattta
ttatatgcaacagttcacatggacgaaaaaacaccacatatgcattatggcgttgttcca
ataactgatgatggtcgtttaagtgctaaagaagttgtaggtaataaaaaagctttaaca
gcgtttcaagatagatttaatgagcatgttaaacaacgaggatatgatttagaacgtggg
caatcaagacaagtaacaaatgctaaacatgagcaaataagtcagtataaacaaaaaaca
gaatatcataagcaagaatatgaacgtgagagccaaaaaacagaccatataaagcaaaag
aacgataaattaatgcaagagtaccaaaaatcgttaaatacgcttaaaaagcctataaat
gttccgtatgagcaagaaactgaaaaagtaggtggtttatttagcaaagaaatacaagaa
actggaaatgttgtaataagccaaaaagatttcaatgaatttcagaaacagataaaagct
gctcaagatatttcggaagattacgagtatataaagtctggtagagccttagatgataaa
gataaggaaatacgagagaaagatgatttattaaataaagcagttgagcgtattgaaaac
gcagacgataattttaaccaactttacgaaaatgcaaagccacttaaagagaatatagaa
atagcgttaaagcttttaaaaatcttactaaaagagttagaacgagttttaggaagaaat
acctttgcggaaagagttaataagttaacagaagatgaaccaaaactaaatggtttagca
ggaaacttagataaaaaaatgaatccagaattatattcagaacaggaacagcaacaagaa
caacaaaagaatcaaaaacgagatagaggtatgcacttatag

DBGET integrated database retrieval system