KEGG   Staphylococcus epidermidis ATCC 12228: SE_p202Help
Entry
SE_p202           CDS       T00110                                 

Definition
hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSE-12228-02:complement(930..1481)
Genome map
AA seq 183 aa AA seqDB search
MNRNNIFIKILFITSFAMILAIVSNHNQTFALTYKKGDVLTTRSTSASGLTGHNGIYIGN
GKVLDTPRVHHYPRVMSVKKWIKSYPKTKVTRPKNSSLGNKAANNAVKYFKGKKIPYKVT
PNPKNIKKTYCSEIVWYSYYKAGKQYMIPEHGVWLPPSIVAPYAFVNKQDVKHNGFKFVD
NKW
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaaataatatattcataaaaattttatttatcacatcatttgctatgattctt
gcaattgttagtaaccacaatcaaacttttgctcttacttataaaaaaggtgatgtctta
acaactagaagtactagtgcaagtggtcttacaggacataacggtatatacataggtaat
ggaaaagttctagacactcctagagttcaccattatccaagagtaatgtcagtgaaaaaa
tggattaaaagctatcctaaaacaaaagtaacacgaccaaaaaattctagtctaggaaat
aaagctgcaaacaacgccgttaaatattttaaaggcaaaaaaataccatataaggttaca
ccaaatcctaaaaatatcaaaaaaacctattgcagcgaaatagtatggtattcctattac
aaagctggaaaacaatatatgatccccgagcatggagtttggttaccaccaagtattgta
gccccatatgcatttgttaataaacaagatgttaagcacaatggttttaaattcgtagat
aataaatggtag

DBGET integrated database retrieval system