KEGG   Staphylococcus epidermidis ATCC 12228: SE_p411Help
Entry
SE_p411           CDS       T00110                                 

Definition
resolvase/integrase
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSE-12228-04:complement(9800..10279)
Genome map
AA seq 159 aa AA seqDB search
MSGSKSKRPGLDKAIEFARSGDTIVVWRLDRLGRNMEDLITLVNELNNRGVSFHSLEENI
TMDKSSSTGQLLFHLFAAFAEFERNLILERSSAGRIAARARGRYGGRPEKLNKQDLKLLK
TLYDNGTPIKTIAEQWKVSRTTIYRYLNKLNNQENKDKN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagtggttcaaaaagtaagcgacctggtttagataaagccattgaatttgcgaggtca
ggagatacgattgttgtttggagactagatagactaggacgtaacatggaagatttaatc
acattagttaatgaacttaataatcgaggcgtgagttttcatagtttagaagaaaatata
acaatggataaatcaagttctacaggacaattgttatttcatttattcgcagcatttgca
gagtttgaacgtaatttaattttagaacgttcttcagcgggacgaattgcagctcgtgct
agaggacgctatggaggtcgacccgaaaaattaaataaacaagatttaaaattactcaaa
acactttatgataatggaacaccaattaaaactattgcagagcaatggaaagtttcacgt
acaacaatctatcgttatctcaataagttaaataaccaagaaaataaagataaaaattag

DBGET integrated database retrieval system