KEGG   Staphylococcus epidermidis ATCC 12228: SE_p503Help
Entry
SE_p503           CDS       T00110                                 

Definition
ABC transporter
Orthology
K18104  
ATP-binding cassette, subfamily B, bacterial AbcA/BmrA [EC:3.6.3.44]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
ABC transporters
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE_p503
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SE_p503
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.44  xenobiotic-transporting ATPase
     SE_p503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSE-12228-05:2578..4305
Genome map
AA seq 575 aa AA seqDB search
MELFNLNVYNILKIAIDNKSKKIYLAVIIIISLIFTLASLYFPLIIKNIITELEKNKVSV
FIICYLILFLILRSVMESINEYLIAKLGNIVIKDLQQNIYDRIVNYPISFFDEYNSGDLS
SRLVNDTEVIKDLITFHIPKVINGLVMIVGAVCLIVLLDWKLTVLILLISPVIFGIIFPL
MKKLENTGEIQQNEISNFISKTQETFKNIRMVKASTAEQSESKSISRYINNLFKVNLYES
KVMSLVSPLVNLLLIFGLLIIAGYGAYRIQNDTLTLSTLIAFIIYSFQLMSPISSISSFI
GEYHKSNGAFKSLTVILSKDIENAKNTYKYNFKLEDKLIFDNVSLEFKEKKILDNISFKL
NKGESLTIIGPSGSGKTTLLNVIEKFYYINSGSITIDGIDINDINTQNLRYNIGLVSQDI
PIISGTIKDNLLYGLNNVSITNFEIKDILKSTMLKDLVINQIDGINSYVGESGNRLSGGE
KQRINIGRVLLKNPNIILLDEATSNLDNESKSEIINSISEITQDKTVLKITHNMHELKED
EQILFIENGKIIFKGKHGELLKNNERYKKFIKNEA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggagttgtttaatttgaacgtatacaatattttaaaaatagctattgataataaaagc
aagaaaatttatttggcagttataattatcatttctttaattttcacattagcttcttta
tatttccctttaataataaaaaatattataacagaacttgaaaaaaataaagtgagtgtt
tttattatttgctatttaattttgtttttaatattaaggtcagttatggaatctataaat
gagtatttaatagctaaacttggaaatatagttataaaagacttacaacaaaatatttat
gatcgaatagtaaactatccaatatcatttttcgatgaatataatagtggagacttatca
agtagactagtaaacgatacagaagtaattaaagatttaataacatttcatattcctaaa
gttattaatggattagttatgattgttggggctgtttgtttaatagtgttattagactgg
aaattgacagtactaattttacttatatctcctgtaatatttggaattatatttccatta
atgaaaaaattagaaaatacaggagagatacaacaaaatgaaatctccaattttatatca
aaaactcaagaaacatttaaaaatattaggatggtaaaagcttctactgcagaacaatct
gagagtaaaagcatttctagatacataaataatttatttaaagtaaatttatatgaaagt
aaggttatgtctttagtatctcctttagtgaaccttttacttatttttggcttactaatt
atagctggatatggcgcatatcgaattcaaaatgatactttaactttaagtactcttatt
gcatttataatttactcattccagttaatgagtcctataagttcaataagtagttttata
ggagaatatcataaatctaatggagcttttaaaagcttaactgttatccttagtaaggat
attgaaaatgctaaaaatacatataaatataattttaagttagaggataaattaatattt
gataatgtaagtttagaatttaaagaaaaaaaaatccttgataatatctcttttaaatta
aataaaggggagtctcttacaattataggtccttcaggatctggaaaaacaacattatta
aatgtaatagaaaaattttattatataaacagtggaagtataactatagatggtatagac
attaatgatatcaacactcaaaatttaagatacaatataggattagttagccaagatata
cctattataagtggtacaataaaagataatttactatatggattgaataatgtaagtatt
accaattttgaaattaaagatattttaaaatctactatgctaaaggatcttgttattaat
caaattgatggtattaatagttatgttggagaaagtggtaatcgtctttcaggcggcgaa
aaacaaagaattaatatagggagagtacttttaaaaaatcctaatattattttattagat
gaagcaacttcaaatctagataatgaatccaaatctgaaattattaactctatatctgaa
ataacacaagataaaactgttttaaaaataacacacaatatgcatgagttaaaagaagac
gaacaaatattatttatagaaaatgggaaaattatttttaaaggaaaacatggtgagttg
ctgaaaaacaatgaaagatataaaaaattcattaaaaatgaggcttag

DBGET integrated database retrieval system