KEGG   Staphylococcus epidermidis ATCC 12228: SE_p507Help
Entry
SE_p507           CDS       T00110                                 

Definition
bla regulator protein blaR1
Orthology
K02172  
bla regulator protein blaR1
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
Module
beta-Lactam resistance, Bla system
Class
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sep00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSE-12228-05:8213..9970
Genome map
AA seq 585 aa AA seqDB search
MAKLLIMSIVSFCFIFLLLLFFRYILKRYFNYMLNYKVWYLTLLAGLIPFIPIKFSFFKF
NNVNNQAPTVESKSHDLNHNINTTKPIQEFTTDIHKFNWDSIDNICTVIWIVLVIILSFK
FLKALLYLKYLKKQSLYLNENEKNKIDTILFNHQYKKNIVIRKAETIQSPITFWYGKYII
LIPSSYFKSVIDKRLKYIILHEYAHAKNRDTLHLIIFNIFSIIMSYNPLVHIVKRKIIHD
NEVEADRFVLNNINKNEFKTYAESIMDSVLNVPFFNKNILSHSFNGKESLLKRRLINIKE
ANLKKQSKLILIFICIFTFLLMVIQSQFLMGQSITDYNYKKPLHNGYQILDKSKIFGSNS
GSFVMYSMKKDKYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWDHKHYP
FDAWNKEQNLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSL
KISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGW
FVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLNGQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttattaataatgagcatagtaagcttttgttttatatttctattgttatta
ttttttaggtacatattaaaacgctattttaattatatgttaaattataaagtttggtat
ctaactcttcttgcaggattaattcctttcattcctattaaattctctttttttaaattt
aataatgtgaataatcaagcgcccacagttgaaagtaagtcacacgacttgaaccataac
ataaataccaccaaacctattcaagagttcacaacagatatccataagtttaattgggat
tcaattgataatatctgcacagttatttggatagttttagttattattttaagttttaaa
tttttgaaagccttattatatcttaaatatttaaagaaacagtcactttatctaaacgaa
aatgaaaaaaataaaatagatacgatacttttcaaccatcaatataaaaaaaatattgtg
attcgaaaagcagagactattcaatctccaataactttttggtatgggaaatatattatt
ttgattcctagttcatattttaaaagtgtaattgacaaaagactaaaatatataatattg
catgaatatgctcatgctaaaaatagagatactttacatttaattatctttaatatcttc
tctattattatgagttacaatccattagtacatattgtaaaaagaaagataattcatgac
aatgaagtagaagccgatagatttgtccttaataatattaacaaaaatgaatttaaaact
tatgcggaatctattatggactccgtattaaatgttccattttttaataaaaatatatta
agccattcatttaatggtaaagagtcattactcaaaagaagattaattaatataaaagaa
gccaatctgaaaaaacagtccaaattaattctaatttttatttgtatttttacttttttg
ctcatggtaattcaaagccagtttttgatggggcaatccataactgattataattataaa
aagcccttacacaacggttaccaaattttagataaaagtaaaatttttggttcaaatagt
ggatctttcgtcatgtacagcatgaagaaagacaaatactatatttataacgaaaaagaa
agtagaaaaaggtattctcctaattcaacttataaaatttatttagctatgtttggactt
gaccgacatattataaatgatgaaaattcacgtatgtcatgggatcataagcattaccct
tttgatgcttggaataaggaacaaaatttaaatacagcaatgcaaaattcagttaattgg
tacttcgaacgtattagcgatcaaataccaaagaactatactgcgactcaactcaagcaa
ttaaattatggtaataaaaatttgggaagttataaaagctattggatggaagatagtttg
aaaatatctaatcttgaacaagtaatagtttttaaaaatatgatggaacaaaataaccat
tttagtaaaaaagcaaagaatcaattatcttcttcattattgattaagaaaaatgaaaag
tatgaactgtatgggaaaacaggtacaggtatagtaaacgggaagtataataatgggtgg
tttgtaggttacgtaattacaaatcatgataagtattattttgctacacatttatcagat
ggaaagccatctgggaaaaatgctgaattaatcagtgaaaaaatattaaaagaaatgggt
gttttaaatggccaataa

DBGET integrated database retrieval system