KEGG   Staphylococcus epidermidis ATCC 12228: SE_p508Help
Entry
SE_p508           CDS       T00110                                 

Definition
penicillinase repressor
Orthology
K02171  
BlaI family transcriptional regulator, penicillinase repressor
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
Module
beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SE_p508
Transcription factors [BR:sep03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SE_p508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSE-12228-05:9960..10340
Genome map
AA seq 126 aa AA seqDB search
MANKQVEISMAEWDVMNIIWGKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKR
YKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDIL
NDISKK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggccaataagcaagttgaaatatctatggctgaatgggatgttatgaatataatatgg
ggtaaaaaatcagtatcagctaatgaaattgtagttgaaattcaaaaatataaagaagtt
agcgataaaacgattagaacattaatcacaagactatataaaaaagagattataaaacga
tacaaatcagagaatatttatttttactcatcaaatattaaagaagacgatattaaaatg
aaaactgctaaaacttttcttaataaactgtatggaggggacatgaaaagtttagtgctg
aattttgcgaaaaatgaagaattaaataacaaagaaattgaagaattgcgagacatttta
aatgatattagtaaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system