KEGG   Staphylococcus epidermidis ATCC 12228: SE_p509Help
Entry
SE_p509           CDS       T00110                                 

Definition
(RefSeq) DNA-invertase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase HTH_7 HTH_11 HTH_23 HTH_22 HTH_24 HTH_36 TrmB Mga HTH_29 HTH_38 MarR_2 MarR Trp_repressor HTH_40 TnsD HTH_28 HTH_IclR Terminase_5 UPF0122 HTH_DeoR HTH_32 HTH_Tnp_4 HTH_5 TetR_N HTH_30 HTH_17 GntR
Motif
Other DBs
NCBI-GeneID: 1463479
NCBI-ProteinID: NP_863212
UniProt: A0A0H2VKD5
Position
pSE-12228-05:10706..11197
Genome map
AA seq 163 aa AA seqDB search
MSGSKSKRPGLDKAIEFARSGDTIVVWRLDRLGRNMEDLITLVNELNERGVSFHSLEENI
TMDKSSSTGQLLFHLFAAFAEFERNLILERSSAGRIAARARGRYGGRPEKLNKQDLNLLK
TLYDNGTPIKTIAEQWKVSRTTIYRYLNKLEDKEDEKQGEVSN
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagtggttcaaaaagtaaaagacctggtttagataaagcaattgaatttgcgaggtca
ggagataccattgttgtttggagactagatagactaggacgtaacatggaggatttaatc
acattagttaatgaacttaacgaacgaggcgtgagttttcatagtttagaagaaaatata
acgatggataaatcaagttctacaggacaattattatttcatttattcgcagcatttgca
gaatttgaacgtaatttaattttagaacgttcttcagctggccgaattgcggcacgtgca
agaggaagatatggagggaggcctgaaaaattaaataaacaagatttgaatttacttaag
acgctttatgataatggcacacccattaaaacaatagcagaacaatggaaagtttcacgt
acaactatttatcgttacctcaataaattggaggacaaggaagatgaaaaacaaggagaa
gtatctaactaa

DBGET integrated database retrieval system