KEGG   Staphylococcus epidermidis ATCC 12228: SE_p509Help
Entry
SE_p509           CDS       T00110                                 

Definition
DNA-invertase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSE-12228-05:10706..11197
Genome map
AA seq 163 aa AA seqDB search
MSGSKSKRPGLDKAIEFARSGDTIVVWRLDRLGRNMEDLITLVNELNERGVSFHSLEENI
TMDKSSSTGQLLFHLFAAFAEFERNLILERSSAGRIAARARGRYGGRPEKLNKQDLNLLK
TLYDNGTPIKTIAEQWKVSRTTIYRYLNKLEDKEDEKQGEVSN
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagtggttcaaaaagtaaaagacctggtttagataaagcaattgaatttgcgaggtca
ggagataccattgttgtttggagactagatagactaggacgtaacatggaggatttaatc
acattagttaatgaacttaacgaacgaggcgtgagttttcatagtttagaagaaaatata
acgatggataaatcaagttctacaggacaattattatttcatttattcgcagcatttgca
gaatttgaacgtaatttaattttagaacgttcttcagctggccgaattgcggcacgtgca
agaggaagatatggagggaggcctgaaaaattaaataaacaagatttgaatttacttaag
acgctttatgataatggcacacccattaaaacaatagcagaacaatggaaagtttcacgt
acaactatttatcgttacctcaataaattggaggacaaggaagatgaaaaacaaggagaa
gtatctaactaa

DBGET integrated database retrieval system