KEGG   Staphylococcus epidermidis ATCC 12228: SE0256Help
Entry
SE0256            CDS       T00110                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sep01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sep00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sep00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sep00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255652..256929
Genome map
AA seq 425 aa AA seqDB search
MSENIIMPKLGMTMKEGTVEEWFKSEGDTVKQGESIVTISSEKLTNDVEAPASGTLLEIK
VQAGEDAEVKAVLGIIGEEGEAIDKDEDDLASEKVKEDNEHEKETQEVKDTSQQSSDNKD
NSPKSAARERIFISPLARNMAEDKGLDINKIKGTGGNHRITKLDIQRVEANGYDYASDTT
SNEDTSHVPTQTVDTSAIGEGLNPMRQRIAQNMRQSLNSTAQLTLHRKVDADRLLDFKDR
LATELKQADQDVKLTVTTLLAKAVVLALKEYGAMNARYEQGELTEYEDVHLGIATSLDEG
LMVPVINHADTKSIGTLAHEIKSSAEAVREGNTGAVQLEGATFTITNMGASGIEYFTPIL
NLGETGILGVGALTKEVVLEADNIKQVSKIPLSLTFDHQILDGAGAADFLKVLAKYIENP
YLLML
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaatattattatgccaaagcttggaatgacaatgaaagagggaactgttgaa
gagtggtttaaatcagagggtgacaccgtaaaacaaggagagagtattgttacaataagc
tctgaaaaattaaccaacgatgttgaagcgccggcgagtgggacattgttagaaattaaa
gtgcaagccggagaagatgcagaggttaaagcggtattaggtataattggagaagaaggg
gaagctattgataaagatgaagatgatttagcatcagaaaaagtaaaagaagacaacgag
catgagaaggaaacgcaagaagttaaagatacatcacaacagtcttccgataataaagat
aattcgcctaaaagcgcagcacgagaaagaatctttatctcacccctcgcacgtaatatg
gctgaggataaaggattagacattaacaagataaaaggcacaggcggtaatcatcgtatt
acaaaactagatattcaacgtgttgaagcaaatgggtacgactatgctagtgatacgaca
tctaatgaagatacaagtcatgttccaacacagactgtggatacaagtgcgattggtgaa
ggattgaatcctatgcgtcaacgtattgctcaaaacatgagacaaagtcttaatagtact
gctcaattaacattacatcgtaaggttgatgcggatcgcttgctagatttcaaagacaga
ttagctacggaacttaaacaagcagatcaagatgttaaattaactgttactacattatta
gctaaagcagtagtgcttgcacttaaagaatatggggcaatgaatgctcgctatgaacaa
ggcgagttaactgagtatgaagatgttcatttaggaatcgcaacgtctctagatgaaggc
cttatggtgccagtgattaatcatgcagatacaaaaagtatcggcactttagcccatgaa
attaaatcatcggctgaggctgttcgggaaggaaacacaggagcagtacaattagaggga
gcaacatttacaattactaatatgggtgctagtggtatagaatactttacaccaatttta
aatttaggtgaaacaggtattctaggcgttggtgctttaactaaagaagtcgtgctagaa
gcggataacattaaacaagtttcaaaaattcctttaagcttgacatttgatcatcaaatt
ttagatggtgcaggtgcggccgattttcttaaagtactagctaaatatatcgaaaaccct
tatttattaatgttatag

DBGET integrated database retrieval system